Details for Arabidopsis Locus AT3G55830

Position : Chr3 ( 5`- 20714946 .. 20717443 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55830

Protein [Map View]
MGGGEVSKEMGACSLAYRRGDQKLRKFVTARSTKFLLFCCIAFVLVTIVCRSSRPWVNSSIAVADRISGSRKGYTLLMNT
WKRYDLLKKSVSHYASCSRLDSIHIVWSEPNPPSESLKEYLHNVLKKKTRDGHEVELRFDINKEDSLNNRFKEIKDLKTD
AVFSIDDDIIFPCHTVDFAFNVWESAPDTMVGFVPRVHWPEKSNDKANYYTYSGWWSVWWSGTYSMVLSKAAFFHKKYLS
LYTNSMPASIREFTTKNRNCEDIAMSFLIANATNAPAIWVKGKIYEIGSTGISSIGGHTEKRTHCVNRFVAEFGKMPLVY
TSMKAVDSRNLWFW*

DNA
ATGGGAGGAGGAGAAGTTAGTAAAGAGATGGGAGCTTGTTCATTAGCGTATCGTCGTGGAGATCAGAAATTACGCAAGTT
CGTGACGGCGAGGAGTACTAAGTTTCTTCTATTTTGCTGCATCGCTTTCGTCTTGGTCACAATCGTTTGCCGATCTTCTC
GTCCTTGGGTTAACAGTTCAATCGCCGTCGCAGATCGGATCTCCGGATCAAGGAAAGGTTATACACTTCTGATGAACACA
TGGAAGAGATATGATCTCTTAAAGAAGTCTGTTTCCCACTATGCATCATGTTCTAGGCTTGACTCTATCCACATTGTATG
GAGTGAACCTAACCCTCCATCAGAGTCTCTGAAAGAGTATCTTCATAATGTTCTGAAGAAAAAGACTCGAGATGGGCATG
AGGTTGAGCTGAGATTTGATATAAACAAAGAAGACAGTTTGAACAACAGATTTAAAGAGATTAAAGACTTGAAAACAGAT
GCTGTCTTCTCAATAGATGATGATATCATATTTCCTTGTCACACGGTAGATTTTGCATTCAACGTTTGGGAAAGTGCTCC
GGATACAATGGTGGGGTTTGTGCCCCGTGTGCATTGGCCTGAAAAATCGAATGATAAAGCCAATTACTACACCTACAGTG
GATGGTGGTCTGTTTGGTGGAGTGGTACATATAGCATGGTACTCTCAAAGGCAGCCTTCTTCCACAAAAAATACCTCAGC
CTTTACACAAATAGCATGCCAGCATCAATCAGGGAATTCACAACAAAGAACAGGAACTGTGAAGATATTGCAATGTCATT
CCTCATCGCAAATGCTACAAACGCTCCTGCTATATGGGTTAAAGGTAAAATATATGAAATCGGTTCAACTGGAATTAGTA
GCATAGGAGGGCACACAGAAAAAAGAACACACTGCGTAAACCGGTTTGTGGCAGAATTTGGGAAAATGCCACTTGTATAC
ACTTCCATGAAAGCCGTGGATAGCCGCAATTTATGGTTCTGGTGA