Details for Arabidopsis Locus AT3G55640

Position : Chr3 ( 5`- 20639833 .. 20642659 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55640

Protein [Map View]
MVMQTEARVGVSSGHGVASSSHRLTQDQRSHIESASQLLAGGLAGAFSKTCTAPLSRLTILFQVQGMHTNAAALRKPSIL
HEASRILNEEGLKAFWKGNLVTIAHRLPYSSVNFYAYEHYKKFMYMVTGMENHKEGISSNLFVHFVAGGLAGITAASATY
PLDLVRTRLAAQTKVIYYSGIWHTLRSITTDEGILGLYKGLGTTLVGVGPSIAISFSVYESLRSYWRSTRPHDSPIMVSL
ACGSLSGIASSTATFPLDLVRRRKQLEGIGGRAVVYKTGLLGTLKRIVQTEGARGLYRGILPEYYKVVPGVGICFMTYET
LKLYFKDLSSNL*

DNA
ATGGTGATGCAGACGGAAGCTAGGGTTGGTGTGAGCTCAGGACATGGCGTAGCTTCGTCTTCTCATCGTTTAACGCAGGA
CCAGAGATCACATATCGAATCGGCGTCGCAGCTCTTAGCCGGAGGACTCGCTGGTGCTTTTAGCAAGACTTGTACTGCTC
CTCTATCTCGTCTCACCATTCTCTTCCAGGTGCAAGGTATGCACACAAATGCTGCAGCTTTAAGAAAGCCAAGCATATTA
CACGAGGCTTCACGGATATTGAATGAAGAAGGATTGAAAGCTTTTTGGAAAGGGAATCTAGTTACTATTGCTCACCGGCT
TCCATATTCTTCTGTTAATTTCTACGCATATGAACACTACAAGAAGTTCATGTATATGGTTACTGGGATGGAAAATCACA
AGGAGGGTATAAGTTCAAACCTTTTTGTACATTTTGTAGCCGGTGGTTTGGCTGGAATCACAGCTGCTTCTGCCACTTAT
CCACTTGATCTTGTTAGAACTCGTCTTGCTGCTCAGACAAAAGTAATCTACTACTCGGGTATCTGGCATACTCTGCGCTC
TATTACAACCGATGAAGGTATCTTGGGCCTCTACAAGGGACTAGGAACAACGCTTGTGGGTGTTGGGCCTAGTATTGCCA
TTAGCTTTTCTGTGTATGAATCATTGAGATCTTATTGGAGGTCAACTAGGCCCCATGATTCCCCTATCATGGTCAGTCTA
GCTTGTGGAAGTCTTTCAGGAATAGCATCTTCAACAGCTACGTTTCCATTGGATCTGGTGAGAAGAAGGAAGCAGCTGGA
AGGAATAGGCGGGCGAGCGGTAGTGTACAAGACAGGTTTGTTAGGCACATTAAAGCGTATTGTTCAAACGGAAGGAGCGA
GAGGCCTGTACAGAGGAATTCTTCCAGAGTACTACAAAGTGGTACCTGGTGTAGGGATTTGCTTCATGACCTACGAGACA
CTCAAGCTTTACTTCAAGGATCTTTCTTCGAATCTATAA