Details for Arabidopsis Locus AT3G55630

Position : Chr3 ( 5`- 20636669 .. 20639492 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55630

Protein [Map View]
MATEDDGELSARYQNTLDALSSLITKRGRLASNNQSHRFRLLFHYLKVLELEDAVSQMKIIHVAGTKGKGSTCTFAESIL
RCYGLRTGLFTSPHLIDVRERFRLNGIEISQEKFVNYFWCCFHKLKEKTSNEVPMPTYFCFLALLAFKIFTTEQVDVVIL
EVGLGGRFDATNVIQKPVVCGISSLGYDHMEILGYTLAEIAAEKAGIFKSGVPAFTVAQPDEAMRVLNEKASKLEVNLQV
VEPLDSSQRLGLQGEHQYLNAGLAVALCSTFLKEIGIEDKNGLDQTNGLPEKFISGLSNAYLMGRAMIVPDSELPEEIVY
YLDGAHSPESMEACAIWFSKQIKQNQERNQKRSEQILLFNCMSVRDPSLLLPRLRSKCIDQGVDFKRAVFVPNVSVYNQV
GSSTNVGTRVESMSWQFGLQRIWESLARGEAKSNSKSDSKGKEEEKSFVFSSLPVAVDWLRDNARQSKQVRFQVLVTGSL
HLVGDLLRFIKK*

DNA
ATGGCAACTGAAGACGATGGTGAATTGTCAGCTCGTTACCAGAACACGTTGGATGCATTGTCGTCTTTGATCACAAAACG
TGGCCGTTTAGCTAGTAACAACCAATCTCACCGATTCCGTTTGCTCTTTCATTATCTCAAGGTTCTTGAGCTTGAAGATG
CAGTTTCACAAATGAAAATCATTCATGTGGCCGGAACTAAAGGAAAGGGATCAACATGTACATTTGCGGAGTCTATTCTT
CGTTGTTACGGTCTTCGAACTGGTCTCTTCACATCTCCTCACTTAATCGATGTCCGAGAGAGATTCCGTCTTAACGGCAT
TGAGATAAGCCAGGAGAAATTTGTGAACTACTTTTGGTGTTGCTTTCATAAGCTCAAGGAGAAAACCAGCAATGAGGTTC
CAATGCCTACTTATTTCTGCTTCCTTGCTTTATTAGCTTTCAAGATTTTCACAACAGAACAGGTTGATGTTGTTATACTA
GAAGTTGGCTTAGGTGGGAGATTCGATGCGACTAATGTGATTCAGAAACCTGTCGTCTGTGGTATTTCTTCTCTAGGGTA
TGACCATATGGAGATTCTTGGATACACACTTGCTGAAATTGCTGCAGAGAAAGCCGGTATCTTCAAGAGTGGAGTTCCTG
CTTTTACAGTGGCTCAACCTGATGAAGCAATGCGTGTACTCAATGAAAAAGCTTCAAAATTGGAGGTGAATCTTCAGGTG
GTGGAACCGTTGGACTCAAGCCAGAGACTCGGGCTTCAAGGCGAACATCAATATCTAAACGCTGGTCTTGCTGTTGCGTT
GTGCTCTACATTTCTTAAAGAGATTGGTATTGAGGACAAGAATGGTTTGGATCAGACAAACGGTTTACCCGAAAAATTCA
TCTCTGGATTGTCAAATGCTTATTTGATGGGACGAGCTATGATAGTGCCTGATTCAGAACTCCCTGAAGAGATTGTGTAT
TACCTTGATGGAGCTCATAGTCCTGAAAGCATGGAAGCTTGCGCTATATGGTTTTCAAAACAGATCAAACAAAACCAAGA
AAGAAACCAGAAAAGATCAGAGCAGATACTCTTGTTCAATTGTATGTCTGTTCGTGACCCGAGTTTGCTTCTTCCGCGAT
TAAGGAGTAAATGCATTGATCAAGGAGTTGATTTCAAGAGAGCCGTTTTTGTGCCAAACGTATCAGTGTACAACCAAGTG
GGATCTTCGACAAACGTTGGCACACGTGTCGAGTCGATGTCGTGGCAGTTCGGTCTTCAGAGGATTTGGGAGAGTTTAGC
TCGAGGTGAAGCAAAATCTAATTCAAAAAGTGATTCTAAAGGCAAAGAAGAAGAGAAGAGTTTCGTTTTCTCGTCACTTC
CTGTGGCTGTTGACTGGCTCCGGGACAATGCTCGCCAAAGTAAACAAGTTCGTTTTCAGGTGTTGGTAACTGGTTCATTA
CATTTGGTGGGTGATCTCTTGAGATTTATCAAGAAATGA