Details for Arabidopsis Locus AT3G55610

Position : Chr3 ( 5`- 20624020 .. 20629093 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55610

Protein [Map View]
MTEIDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGFEVILVSSGAVGLGRQRLRYRQLVNSSF
ADLQKPQMELDGKACAGVGQSSLMAYYETMFDQLDVTVAQMLVTDSSFRDKDFRKQLSETVKAMLRMRVIPVFNENDAIS
TRRAPYKDSTGIFWDNDSLAALLSLELKADLLILLSDVEGLYTGPPSDSTSKLIHTFIKEKHQDEITFGEKSKLGRGGMT
AKVKAAVNAAYGGVPVIITSGYAAENISKVLRGLRVGTLFHQDAHLWAPVVDTTSRDMAVAARESSRKLQALSSEDRKQI
LHDIANALEVNEKTIKAENDLDVAAAQEAGYEESLVARLVMKPGKISSLAASVRQLAEMEDPIGRVLKKTQVADDLILEK
TSSPIGVLLIVFESRPDALVQIASLAIRSGNGLLLKGGKEARRSNAILHKVITDAIPETVGGKLIGLVTSREEIPDLLKL
DDVIDLVIPRGSNKLVSQIKNSTKIPVLGHADGICHVYVDKSGKLDMAKRIVSDAKLDYPAACNAMETLLVHKDLEQNGF
LDDLIYVLQTKGVTLYGGPRASAKLNIPETKSFHHEYSSKACTVEIVEDVYGAIDHIHQHGSAHTDCIVTEDSEVAEIFL
RQVDSAAVFHNASTRFSDGFRFGLGAEVGISTSRIHARGPVGVEGLLTTRWIMRGKGQVVDGDNGIVYTHKDLPVLQRTE
AVENGI*

DNA
ATGACGGAGATCGATCGTTCACGCGCGTTCGCCAAAGACGTTAAGCGTATCGTCGTCAAGGTTGGGACTGCAGTTGTTAC
TGGGAAAGGTGGAAGATTGGCTCTTGGACGTTTAGGAGCTATCTGTGAACAGCTTGCGGAGTTAAACTCAGATGGATTTG
AGGTCATTTTGGTGTCATCTGGTGCCGTTGGTCTTGGTCGACAAAGGCTTCGATACAGACAATTAGTCAACAGCAGTTTT
GCAGATTTACAGAAGCCACAAATGGAACTTGATGGGAAGGCTTGTGCTGGTGTTGGGCAGAGCAGTCTCATGGCTTACTA
TGAGACTATGTTTGACCAGTTGGATGTGACGGTTGCTCAAATGCTTGTGACCGATAGCAGTTTTAGAGATAAGGATTTCA
GGAAGCAACTTAGTGAAACTGTCAAAGCGATGCTGAGGATGAGGGTTATTCCAGTTTTCAATGAGAATGATGCTATAAGC
ACTCGCAGAGCCCCCTACAAGGATTCTACTGGTATATTTTGGGATAATGACAGCTTAGCCGCTCTTCTGTCGCTAGAGCT
GAAAGCTGATCTTTTGATTCTTCTAAGTGATGTTGAGGGCCTTTACACTGGCCCTCCAAGTGATTCTACCTCAAAATTAA
TACACACATTCATTAAAGAAAAACACCAGGACGAGATTACTTTTGGCGAAAAGTCCAAATTAGGACGAGGGGGTATGACT
GCAAAAGTTAAAGCTGCTGTTAATGCAGCTTATGGTGGCGTTCCTGTTATCATAACCAGTGGATATGCAGCTGAGAATAT
AAGTAAAGTCCTTAGAGGACTGCGTGTTGGTACCCTGTTCCATCAAGATGCTCATTTATGGGCTCCGGTCGTAGATACTA
CTTCTCGTGACATGGCAGTTGCTGCAAGGGAAAGCTCAAGAAAGCTTCAGGCCTTATCTTCAGAAGATAGGAAACAAATT
CTACACGACATTGCCAATGCCCTTGAAGTAAATGAGAAAACAATTAAAGCTGAGAATGATTTAGATGTTGCTGCAGCACA
AGAAGCTGGATATGAAGAGTCTTTGGTAGCTCGCTTAGTTATGAAGCCTGGGAAGATCTCAAGCCTTGCAGCTTCCGTTC
GCCAGCTAGCCGAAATGGAAGATCCAATAGGCCGTGTATTAAAGAAAACTCAGGTTGCAGATGATCTTATTTTAGAGAAG
ACCTCATCACCAATAGGTGTTCTTCTGATTGTTTTTGAATCCCGGCCTGATGCACTTGTTCAGATAGCTTCGCTTGCAAT
CCGGAGTGGAAATGGTCTTCTGCTGAAGGGTGGAAAGGAGGCTCGTCGATCAAATGCTATCTTACACAAGGTGATCACTG
ATGCAATTCCGGAGACTGTTGGAGGTAAACTCATAGGACTTGTGACCTCAAGAGAGGAGATTCCTGATTTGCTCAAGCTT
GATGACGTTATTGATCTTGTGATCCCAAGAGGCAGCAACAAGCTTGTTTCTCAAATAAAAAACTCGACGAAAATCCCAGT
GCTAGGCCATGCTGATGGAATCTGTCATGTATATGTTGATAAGTCTGGTAAACTGGACATGGCAAAGCGCATTGTTTCCG
ATGCAAAGTTGGACTATCCAGCAGCCTGTAATGCGATGGAAACCCTTCTTGTACATAAAGATTTGGAGCAGAATGGTTTT
CTCGATGATCTTATTTATGTTCTGCAAACCAAAGGCGTCACTTTGTATGGTGGGCCAAGAGCAAGTGCAAAACTGAATAT
TCCGGAAACAAAATCATTTCACCACGAGTACAGTTCCAAGGCCTGCACCGTTGAAATTGTAGAAGACGTATATGGTGCTA
TAGATCATATTCACCAACATGGAAGTGCACACACTGATTGCATAGTGACGGAAGATAGTGAAGTAGCAGAAATATTCCTC
CGCCAAGTGGACAGTGCTGCTGTTTTCCACAATGCAAGCACAAGATTCTCTGATGGTTTTAGGTTCGGACTTGGTGCTGA
GGTGGGAATAAGCACAAGCAGGATTCATGCCCGTGGTCCAGTTGGAGTTGAAGGATTATTGACAACAAGATGGATAATGA
GAGGAAAGGGACAAGTTGTGGATGGAGACAATGGAATCGTTTACACCCATAAGGATCTTCCTGTCTTACAAAGGACAGAG
GCTGTTGAGAATGGAATTTAG