Details for Arabidopsis Locus AT3G55605

Position : Chr3 ( 5`- 20622620 .. 20624002 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55605

Protein [Map View]
MGFALCIRRSASTLASVCGRVARAQAVSAIVNRSSLVPKPSLLRPFVSRGFPYSTATEPLKSDQTLIQVIDSEIKDSFEA
DDHDADEETIDSSDFPFKIEDNPGHRTVTLTREYNGEQIKVEVSMPGLAMDENEDDVDDDEDGDGRHEKSNESSIPLVVT
VTKKSGLSLEFSCTAFPDEIVIDGLSVNRPDDSSEEQLTYDGPDFQELDENMRKSFHKFLETRGIKASATDFLYEYMMKK
DSREYLLWLKKLKTFVQE*

DNA
ATGGGTTTCGCTTTGTGCATTCGTAGATCAGCTTCTACTTTAGCTTCCGTGTGTGGTCGTGTGGCTCGAGCTCAAGCCGT
CTCCGCTATCGTTAATCGCTCGTCTCTTGTTCCCAAGCCATCTCTGCTTCGGCCCTTCGTCTCTCGTGGCTTTCCTTATT
CGACGGCCACTGAGCCGTTAAAGTCCGATCAGACGCTTATACAAGTGATTGACTCTGAGATCAAGGATTCTTTCGAAGCA
GATGATCACGATGCGGATGAAGAGACGATAGACTCTAGTGACTTTCCTTTCAAAATCGAAGATAATCCTGGACACAGGAC
TGTGACATTGACTAGAGAATACAATGGAGAGCAGATTAAAGTAGAAGTAAGCATGCCTGGTCTTGCCATGGATGAAAATG
AAGATGATGTGGATGACGATGAAGATGGTGATGGTCGTCATGAGAAATCGAATGAATCAAGCATTCCACTTGTTGTCACT
GTGACCAAGAAGAGTGGACTTAGCCTAGAGTTTAGCTGCACTGCTTTCCCTGATGAGATTGTCATTGATGGTTTGTCTGT
GAACCGTCCAGATGATTCTTCTGAAGAACAGTTGACTTATGATGGGCCAGATTTTCAGGAGTTGGATGAGAATATGCGCA
AGTCGTTCCACAAGTTTCTAGAGACGAGAGGAATCAAAGCAAGCGCAACGGATTTCTTGTATGAGTACATGATGAAGAAA
GATAGCAGAGAGTACTTACTATGGTTGAAGAAGCTCAAAACCTTTGTCCAAGAATGA