Details for Arabidopsis Locus AT3G55580

Position : Chr3 ( 5`- 20612700 .. 20615920 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55580

Protein [Map View]
MNGEGKLETGGTSAAATPKEEKEEEEVVSQRVVYMWGYLPGASPQRSPLMSPVEVKIPPAVESSWKDVSGGGCGFAMATA
ESGKLITWGSTDDLGQSYVTSGKHGETPEPFPLPPEVCVQKAEAGWAHCVAVTENQQVYTWGWRECIPTGRVFGQVDGDS
CERNISFSTEQVSSSSQGKKSSGGTSSQVEGRGGGEPTKKRRISPSKQAAENSSQSDNIDLSALPCLVSLAPGVRIVSVA
AGGRHTLALSDIGQVWGWGYGGEGQLGLGSRVRLVSSPHPIPCIEPSSYGKATSSGVNMSSVVQCGRVLGSYVKKIACGG
RHSAVITDTGALLTFGWGLYGQCGQGSTDDELSPTCVSSLLGIRIEEVAAGLWHTTCASSDGDVYAFGGNQFGQLGTGCD
QAETLPKLLEAPNLENVNVKTISCGARHTAVITDEGRVFCWGWNKYGQLGIGDVIDRNAPAEVRIKDCFPKNIACGWWHT
LLLGQPTL*

DNA
ATGAATGGCGAGGGAAAATTGGAGACTGGTGGAACTAGCGCCGCCGCCACACCAAAAGAGGAGAAGGAAGAAGAAGAAGT
AGTTTCCCAGAGAGTAGTGTACATGTGGGGTTACTTACCCGGAGCTTCACCGCAACGGTCTCCTCTGATGTCACCAGTCG
AAGTAAAGATTCCTCCGGCAGTCGAAAGTTCATGGAAAGATGTCTCTGGTGGTGGATGCGGTTTCGCAATGGCTACTGCA
GAGTCAGGGAAGCTAATTACATGGGGTTCTACAGATGATCTAGGTCAAAGCTACGTCACATCTGGGAAACACGGGGAGAC
TCCAGAGCCATTTCCTCTTCCTCCAGAGGTTTGTGTACAGAAAGCTGAAGCTGGATGGGCTCATTGTGTGGCAGTAACAG
AGAATCAACAAGTTTATACATGGGGATGGAGGGAATGTATACCCACTGGGAGAGTCTTCGGACAAGTAGATGGAGATTCT
TGTGAAAGAAACATATCGTTCTCGACAGAGCAAGTGAGTTCTAGTTCTCAAGGGAAAAAATCTAGTGGTGGAACGTCTTC
TCAAGTTGAAGGTAGAGGTGGAGGGGAGCCAACAAAGAAAAGGAGGATTTCACCGTCAAAGCAAGCTGCTGAAAATTCAT
CACAGTCTGACAACATTGACCTCTCGGCATTGCCTTGCCTTGTATCGTTGGCCCCAGGAGTTAGGATTGTTAGTGTTGCT
GCTGGTGGTCGTCATACTCTAGCATTATCAGATATTGGACAGGTGTGGGGTTGGGGTTATGGAGGAGAAGGACAGCTTGG
ATTGGGCTCTCGTGTACGTCTAGTCTCCTCTCCTCATCCTATTCCATGCATTGAGCCTTCTTCTTATGGAAAAGCCACCA
GTTCTGGTGTAAACATGAGTTCAGTAGTGCAATGCGGCCGAGTTCTTGGAAGTTATGTAAAAAAAATTGCATGTGGAGGG
CGACACAGTGCTGTGATTACAGATACTGGAGCGCTCCTTACATTTGGTTGGGGGCTTTATGGACAGTGTGGCCAAGGAAG
TACAGATGATGAACTAAGTCCTACATGTGTGTCGTCTTTGTTGGGAATCCGAATAGAAGAAGTGGCTGCAGGTCTATGGC
ACACGACCTGCGCTTCATCGGATGGTGATGTTTATGCGTTTGGTGGAAACCAATTTGGCCAGTTAGGTACTGGTTGTGAT
CAAGCTGAGACTCTTCCAAAACTATTGGAGGCTCCAAATTTGGAAAACGTAAACGTCAAAACCATCTCCTGCGGGGCTCG
CCACACAGCTGTAATCACAGATGAAGGGAGAGTATTCTGCTGGGGATGGAACAAATACGGACAGTTGGGTATAGGAGATG
TGATTGACAGGAATGCACCTGCAGAGGTTAGAATCAAAGATTGCTTCCCCAAAAACATTGCATGCGGTTGGTGGCATACT
CTGCTTCTAGGCCAACCAACTCTATGA