Details for Arabidopsis Locus AT3G55570

Position : Chr3 ( 5`- 20610166 .. 20610671 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55570

Protein [Map View]
MFPFTHVHAFNKGNEEVYMDVENGKNGEGSVFRMPLHYPRYSKEDYQDMPEWKLDRVLADYGLSTYGDLAHKRDFAIGAF
LWISTRNPKLYQEKSINSKLKKDTKSAHA*

DNA
ATGTTTCCATTTACACATGTTCATGCGTTTAACAAAGGCAATGAAGAAGTATATATGGATGTTGAAAATGGCAAGAACGG
TGAAGGGAGTGTGTTTCGCATGCCTCTTCATTACCCAAGATACTCCAAAGAAGATTACCAAGACATGCCAGAGTGGAAGC
TCGACAGGGTTTTAGCAGATTACGGTTTGTCTACTTATGGTGACTTGGCTCATAAGCGTGACTTTGCTATTGGAGCTTTT
CTCTGGATTTCAACTCGTAATCCAAAGCTTTATCAAGAAAAGTCCATCAACTCCAAACTGAAGAAAGATACAAAATCAGC
TCATGCATAA