Details for Arabidopsis Locus AT3G55530

Position : Chr3 ( 5`- 20595126 .. 20597603 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55530

Protein [Map View]
MSFVFRGSRGDLESGFSGGFLPERRAMRVHGARPVNSNSLAFLVTVLLLFMILNSHQMPPNFLLWLVLGVFLMATTLRMY
ATCQQLQAHAQAQAAAASGLFSHTELRLHVPPSIALATRGRLQGLRLQLALLDREFDDLDYETLRALDSDNVSTTSMSEE
EINALPVHKYKVLDPENGCSLAKQASTSSSAEKMLDSANESKKGTEDELTCSVCLEQVTVGEIVRTLPCLHQFHAGCIDP
WLRQQGTCPVCKFRAHSGWQEQDEIDDDASDMV*

DNA
ATGAGCTTTGTTTTCCGGGGAAGTAGAGGAGATTTAGAAAGCGGATTCTCGGGTGGTTTTCTACCCGAAAGACGAGCTAT
GCGTGTTCATGGAGCTCGACCAGTTAATTCTAATTCCCTCGCTTTTCTGGTTACAGTTCTTTTGCTGTTTATGATTCTCA
ATTCGCATCAGATGCCTCCTAATTTCCTGCTGTGGCTTGTGCTTGGGGTGTTTTTGATGGCAACGACGCTTAGGATGTAT
GCTACTTGCCAACAACTTCAAGCTCATGCTCAGGCTCAGGCTGCAGCAGCAAGTGGCCTCTTTAGCCATACTGAGCTGAG
GTTGCATGTGCCTCCTTCCATTGCTCTTGCTACGAGAGGGCGTCTTCAGGGACTTAGGCTCCAGCTGGCTCTTCTTGATC
GGGAATTTGATGACTTAGATTATGAAACTTTAAGAGCACTTGATTCTGATAATGTTTCCACAACTTCTATGAGCGAGGAA
GAGATAAATGCACTTCCAGTTCACAAGTACAAGGTGTTGGATCCTGAAAATGGTTGCTCTTTGGCAAAGCAAGCGTCAAC
CTCATCCTCAGCTGAGAAGATGCTAGATTCTGCCAATGAAAGTAAAAAAGGAACAGAAGATGAGCTCACATGTAGTGTTT
GCCTAGAACAAGTTACCGTAGGGGAAATCGTTCGCACCTTACCTTGTTTGCATCAGTTTCATGCAGGATGTATCGATCCA
TGGTTGAGACAGCAAGGAACATGTCCTGTCTGTAAATTTAGAGCTCATTCAGGATGGCAAGAACAAGATGAGATTGATGA
TGATGCTTCCGACATGGTTTGA