Details for Arabidopsis Locus AT3G55515

Position : Chr3 ( 5`- 20590923 .. 20591162 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55515

Protein [Map View]
MSRLRNSAQLQLSKKESLGDNGGALNTTRSSRQKQGKYGFTRKCGRLVKEQRARFYIMRRCVVMLICWTDHNNNNSDHS*

DNA
ATGTCTCGACTGAGAAACTCGGCACAGTTGCAGCTATCGAAAAAGGAAAGTCTTGGAGACAACGGAGGCGCGTTGAACAC
CACGCGTTCCTCTAGACAGAAACAGGGGAAATACGGTTTCACGAGGAAGTGTGGGAGATTGGTGAAAGAACAAAGAGCTC
GCTTTTACATCATGAGGAGATGCGTCGTTATGCTTATTTGCTGGACTGATCATAATAATAACAACTCTGACCACTCCTAA