Details for Arabidopsis Locus AT3G55460

Position : Chr3 ( 5`- 20560808 .. 20563762 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55460

Protein [Map View]
MRRYSPPYYSPPRRGYGGRGRSPPPPPPRRGYGGGGGGGGRRGSSHGSLLVRNIPLDCRPEELREPFERFGPVRDVYIPR
DYYSGQPRGFAFVEFVDAYDAGEAQRSMNRRSFAGREITVVVASESRKRPEEMRVKTRTRSREPSGSRDRSHGRSRSRSI
SRSRSPRRPSDSRSRYRSRSYSPAPRRRGGPPRGEEDENYSRRSYSPGYEGAAAAAPDRDRNGDNEIREKPGYEAEDRRR
GGRAVSRSPSGSRSRSVEVSPR*

DNA
ATGAGGAGATACAGTCCGCCTTATTACAGTCCTCCGAGGAGAGGATACGGTGGTCGAGGTAGAAGTCCTCCTCCTCCTCC
TCCTCGACGTGGATATGGTGGTGGTGGTGGTGGTGGTGGACGTAGAGGATCTAGCCATGGAAGTCTCTTGGTTCGTAACA
TTCCTCTTGATTGCAGACCAGAAGAGCTTCGTGAGCCCTTTGAGAGGTTTGGACCTGTGAGAGATGTCTATATCCCCAGA
GACTATTACTCAGGGCAACCGCGGGGGTTTGCGTTTGTGGAGTTTGTTGATGCATATGATGCTGGGGAGGCTCAAAGAAG
CATGAACAGGAGAAGCTTTGCTGGAAGAGAGATAACGGTGGTTGTTGCTTCAGAGTCTAGGAAAAGGCCTGAAGAGATGC
GTGTGAAGACTAGGACTCGTAGTAGGGAACCTTCAGGCTCCAGGGATCGTTCTCATGGACGGTCTCGTTCACGTTCAATC
TCTCGATCACGTTCTCCACGTCGTCCGTCAGATTCTAGAAGCAGATACCGATCAAGGTCTTACTCTCCTGCACCAAGACG
AAGAGGAGGTCCTCCTCGTGGGGAAGAAGATGAAAATTACAGTCGTAGGTCCTACTCCCCTGGCTATGAAGGTGCTGCTG
CTGCTGCTCCAGATCGGGACAGAAATGGAGACAATGAGATTAGAGAAAAACCGGGCTATGAAGCAGAGGATAGACGTCGT
GGTGGAAGAGCAGTTTCAAGGTCGCCATCAGGATCCAGGTCCAGGTCTGTGGAGGTATCTCCAAGATGA