Details for Arabidopsis Locus AT3G55440

Position : Chr3 ( 5`- 20553690 .. 20556560 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55440

Protein [Map View]
MARKFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPLVKSTLRSDFFVAAQNCWVKKGGAFTGEVS
AEMLVNLDIPWVILGHSERRAILNESSEFVGDKVAYALAQGLKVIACVGETLEEREAGSTMDVVAAQTKAIADRVTNWSN
VVIAYEPVWAIGTGKVASPAQAQEVHDELRKWLAKNVSADVAATTRIIYGGSVNGGNCKELGGQADVDGFLVGGASLKPE
FIDIIKAAEVKKSA*

DNA
ATGGCCAGAAAGTTCTTCGTCGGAGGCAACTGGAAATGTAACGGAACTGCTGAGGAGGTGAAGAAGATTGTGAACACTCT
TAATGAAGCTCAGGTTCCTTCACAGGATGTTGTAGAGGTTGTGGTTAGCCCTCCATATGTTTTTCTTCCCCTGGTTAAGA
GCACATTGAGGTCTGACTTTTTTGTTGCGGCACAAAACTGTTGGGTTAAGAAAGGAGGTGCTTTCACTGGTGAAGTGAGT
GCGGAGATGCTTGTGAACTTGGATATTCCATGGGTTATCCTTGGTCACTCTGAAAGGAGGGCAATCCTTAATGAATCAAG
CGAGTTCGTCGGAGACAAGGTTGCCTATGCACTTGCTCAAGGTTTGAAAGTGATTGCTTGTGTTGGTGAGACTCTTGAGG
AGCGGGAAGCTGGATCGACCATGGATGTTGTGGCTGCCCAGACCAAGGCTATTGCCGATCGGGTGACAAACTGGTCAAAT
GTTGTCATAGCCTATGAACCAGTGTGGGCCATTGGAACCGGAAAGGTCGCTAGCCCAGCCCAAGCTCAAGAAGTACACGA
TGAGCTGAGGAAATGGCTGGCCAAGAACGTGAGTGCTGATGTCGCTGCTACAACCCGCATCATTTATGGAGGATCCGTCA
ATGGTGGTAACTGCAAGGAGCTAGGTGGACAGGCCGATGTTGATGGTTTCTTGGTCGGTGGTGCTTCTCTAAAGCCTGAG
TTTATCGACATCATTAAGGCCGCAGAGGTGAAGAAAAGTGCCTAA