Details for Arabidopsis Locus AT3G55400

Position : Chr3 ( 5`- 20535631 .. 20539067 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55400

Protein [Map View]
MAARINTSLHNALSFLKPFNTPLNTKPFSFRRNSFRFSKKLPYYSQFSSGKRALYCTSSSQESTVDEGETFVLTTPLYYV
NAPPHMGSAYTTIAADSIARFQRLLGKKVIFITGTDEHGEKIATSAAANGRNPPEHCDLISQSYRTLWKDLDIAYDKFIR
TTDPKHEAIVKEFYARVFANGDIYRADYEGLYCVNCEEYKDEKELLENNCCPVHQMPCVARKEDNYFFALSKYQKPLEDI
LAQNPRFVQPSYRLNEVQSWIKSGLRDFSISRALVDWGIPVPDDDKQTIYVWFDALLGYISALTEDNKQQNLETAVSFGW
PASLHLIGKDILRFHAVYWPAMLMSAGLELPKMVFGHGFLTKDGMKMGKSLGNTLEPFELVQKFGPDAVRYFFLREVEFG
NDGDYSEDRFIKIVNAHLANTIGNLLNRTLGLLKKNCESTLVVDSTVAAEGVPLKDTVEKLVEKARTNYENLSLSSACEA
VLEIGNAGNTYMDQRAPWFLFKQGGVSAEEAAKDLVIILEVMRVIAVALSPVAPCLSLRIYSQLGYTEDQFNSITWSDTK
WGGLKGGQVMEQASPVFARIELNPEKEEDEKKPKVGKKTGKAKVKVVEQTPTVAEA*

DNA
ATGGCGGCGAGGATAAACACTTCGCTTCATAACGCCCTCTCTTTTTTAAAGCCTTTTAACACTCCCCTCAATACCAAACC
ATTCTCTTTTAGAAGAAACAGCTTCAGATTTTCCAAAAAGCTTCCTTATTATTCTCAGTTTTCCTCAGGGAAGAGAGCTC
TCTATTGCACTTCCAGTTCCCAGGAAAGTACCGTCGATGAAGGCGAGACATTTGTCCTCACCACTCCTCTTTATTACGTT
AATGCCCCTCCCCACATGGGTAGTGCTTACACCACTATCGCCGCCGATTCAATTGCTCGTTTCCAGAGACTGCTTGGTAA
GAAGGTTATCTTTATCACAGGAACAGATGAACATGGTGAGAAGATAGCTACTTCAGCAGCTGCTAATGGACGTAATCCTC
CTGAACATTGTGACCTCATTTCTCAATCTTATAGAACTCTTTGGAAAGATCTCGATATAGCTTATGACAAATTCATTAGA
ACTACTGATCCTAAGCATGAAGCTATTGTAAAAGAGTTCTACGCTCGTGTTTTCGCAAACGGTGATATTTACAGAGCTGA
TTATGAAGGTCTTTACTGTGTTAACTGCGAGGAATATAAGGATGAGAAAGAGTTGCTTGAAAACAATTGTTGCCCTGTCC
ATCAAATGCCATGTGTTGCAAGGAAAGAAGATAACTACTTCTTTGCTTTGTCGAAATATCAGAAACCACTTGAAGACATT
TTGGCCCAGAATCCTCGTTTTGTGCAGCCTTCGTATCGTCTTAATGAGGTACAAAGTTGGATAAAGAGTGGCTTAAGAGA
TTTTTCCATTTCTCGAGCATTAGTGGATTGGGGAATTCCTGTTCCCGACGACGATAAGCAAACCATATATGTTTGGTTTG
ATGCTCTACTTGGTTACATATCAGCTCTAACAGAGGACAACAAACAACAAAATCTAGAAACTGCTGTTTCATTTGGCTGG
CCTGCTTCATTGCATTTGATCGGAAAGGATATTCTACGATTTCACGCTGTCTACTGGCCTGCCATGCTAATGTCTGCTGG
TCTTGAACTTCCCAAGATGGTGTTTGGCCATGGGTTTCTGACAAAGGATGGAATGAAGATGGGAAAATCGTTGGGGAATA
CTCTAGAACCGTTTGAGTTGGTTCAGAAATTTGGGCCAGATGCCGTGAGGTATTTCTTCCTACGGGAGGTTGAATTTGGA
AACGATGGGGACTATTCAGAAGACCGATTTATAAAAATCGTCAATGCACATCTCGCCAACACTATAGGAAATCTTCTTAA
CCGTACTCTTGGTCTTCTTAAAAAGAACTGTGAATCCACTTTAGTGGTAGACTCGACAGTTGCAGCCGAAGGAGTTCCTT
TGAAAGACACAGTGGAGAAGCTGGTTGAGAAGGCTAGGACAAACTATGAAAATCTGTCACTATCATCAGCGTGTGAAGCT
GTTTTAGAGATTGGAAATGCGGGAAATACCTACATGGATCAACGAGCACCATGGTTTCTGTTCAAACAAGGTGGTGTCTC
AGCAGAAGAGGCAGCCAAGGATCTGGTGATTATACTGGAAGTAATGAGAGTCATAGCGGTTGCGTTATCCCCCGTTGCAC
CTTGCCTAAGTCTGAGGATCTATTCACAGCTTGGCTATACAGAGGATCAATTCAATAGCATAACCTGGAGTGACACCAAA
TGGGGAGGGCTAAAGGGAGGACAAGTAATGGAGCAAGCGAGTCCCGTATTTGCAAGGATCGAGCTGAATCCAGAGAAAGA
AGAAGATGAGAAGAAGCCAAAGGTTGGTAAGAAAACTGGCAAAGCCAAGGTCAAAGTAGTAGAGCAAACTCCTACAGTAG
CTGAAGCTTAA