Details for Arabidopsis Locus AT3G55350

Position : Chr3 ( 5`- 20518391 .. 20520875 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55350

Protein [Map View]
MGPIKTIKKKKRAEKKVDRNVLLAATAAATSASAAAALNNNDDDDDSSSQSLDWWDGFSRRIYGGSTDPKTFESVFKISR
KTFDYICSLVKADFTAKPANFSDSNGNPLSLNDRVAVALRRLGSGESLSVIGETFGMNQSTVSQITWRFVESMEERAIHH
LSWPSKLDEIKSKFEKISGLPNCCGAIDITHIVMNLPAVEPSNKVWLDGEKNFSMTLQAVVDPDMRFLDVIAGWPGSLND
DVVLKNSGFYKLVEKGKRLNGEKLPLSERTELREYIVGDSGFPLLPWLLTPYQGKPTSLPQTEFNKRHSEATKAAQMALS
KLKDRWRIINGVMWMPDRNRLPRIIFVCCLLHNIIIDMEDQTLDDQPLSQQHDMNYRQRSCKLADEASSVLRDELSDQLC
GKNSSA*

DNA
ATGGGACCAATCAAAACGATAAAGAAGAAGAAGAGAGCAGAGAAGAAGGTTGATCGGAACGTATTGCTTGCTGCTACTGC
TGCTGCTACTTCCGCATCCGCCGCCGCTGCTCTTAATAACAACGACGACGACGACGACTCATCATCTCAGTCTTTGGATT
GGTGGGATGGATTCTCTCGCCGTATTTATGGAGGGTCAACGGATCCAAAGACATTTGAGTCAGTTTTCAAAATATCAAGG
AAGACATTTGACTACATTTGCTCTCTTGTGAAAGCCGATTTCACAGCAAAGCCTGCAAATTTCAGCGACTCAAATGGGAA
CCCTTTATCTCTCAATGACCGTGTAGCTGTGGCGCTTAGGAGGCTTGGCTCTGGTGAATCTCTCTCTGTCATTGGAGAGA
CCTTTGGGATGAACCAGTCAACAGTCTCCCAAATCACTTGGCGCTTTGTTGAATCAATGGAAGAGAGAGCAATACACCAT
CTCTCATGGCCTTCGAAACTCGATGAAATAAAATCAAAGTTTGAGAAAATCTCAGGTCTTCCTAACTGCTGTGGCGCTAT
CGACATTACACATATTGTTATGAACCTTCCTGCTGTGGAACCGTCAAACAAAGTTTGGTTGGACGGAGAAAAGAACTTCA
GCATGACTTTGCAGGCCGTAGTAGACCCGGACATGAGATTCCTCGATGTAATAGCTGGTTGGCCTGGGAGTTTAAATGAT
GATGTTGTCCTCAAGAACTCAGGATTCTACAAACTAGTTGAGAAAGGGAAGAGACTGAACGGGGAAAAGTTACCGCTCTC
AGAAAGAACCGAGCTAAGAGAATACATAGTAGGTGATTCAGGTTTTCCTCTTCTTCCATGGCTTCTCACTCCATACCAAG
GCAAACCCACGTCGCTTCCTCAAACCGAGTTCAACAAAAGACACTCCGAGGCAACAAAAGCCGCGCAGATGGCACTATCG
AAGCTTAAAGACAGGTGGAGGATAATAAACGGGGTAATGTGGATGCCTGATAGAAACCGGTTACCAAGGATAATCTTTGT
CTGTTGCTTGCTGCACAACATTATTATCGATATGGAGGATCAAACTTTGGATGACCAACCTTTGTCTCAGCAACATGACA
TGAACTACAGACAACGAAGCTGCAAGCTTGCCGATGAGGCTTCATCGGTCTTGAGAGATGAACTCTCTGACCAACTGTGT
GGAAAAAATTCATCAGCTTGA