Details for Arabidopsis Locus AT3G55270

Position : Chr3 ( 5`- 20496081 .. 20500019 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55270

Protein [Map View]
MVGREDAMGNDEAPPGSKKMFWRSASWSASRTASQVPEGDEQSLNIPCAISSGPSRRCPAAPLTPRSHHNSKARACLPPL
QPLAISRRSLDEWPKAGSDDVGEWPHPPTPSGNKTGERLKLDLSSTQQRVTDKSSGLAKREKIAFFDKECSKVADHIYVG
GDAVAKDKSILKNNGITHILNCVGFICPEYFKSDFCYRSLWLQDSPSEDITSILYDVFDYFEDVREQSGRIFVHCCQGVS
RSTSLVIAYLMWREGQSFDDAFQYVKSARGIADPNMGFACQLLQCQKRVHAFPLSPTSLLRMYKMSPHSPYDPLHLVPKL
LNDPCPGSLDSRGAFIIQLPSAIYIWVGRQCETIMEKDAKAAVCQIARYEKVEAPIMVVREGDEPVYYWDAFASILPMIG
GSVIKVQPGDRKVDAYNLDFEIFQKAIEGGFVPTLASSNNEHETHLPARENSWSSLKCKFASRFDKGFRYVSKTPLSRVY
SDSMMIVHSSGSPSSTTSSSSTASPPFLSPDSVCSTNSGNSLKSFSQSSGRSSLRPSIPPSLTLPKFSSLSLLPSQTSPK
ESRGVNTFLQPSPNRKASPSLAERRGSLKGSLKLPGLADSNRGTPAFTLHPDDSNDIVFNLEGIRNGDLYPPSDCKGTSV
DSDLPEKEIISLISCSKSDRHKSGGDTDSSGQPLACRWPSMEMITKLSRAYLDSESVIAIPLPSDAVGETGSRNLYIWIG
KSFSLDNNCSLVDSNKAADTVENVDWVQIGESILCQMDLPKDTPIKIVRESEDQTELLALLSAL*

DNA
ATGGTGGGAAGAGAGGATGCGATGGGGAATGATGAAGCTCCTCCTGGTTCTAAGAAAATGTTTTGGCGGTCTGCCTCTTG
GTCTGCTTCACGGACTGCATCACAAGTTCCTGAGGGTGATGAGCAAAGCCTGAACATTCCGTGTGCTATTAGTTCTGGGC
CGAGTCGAAGATGTCCAGCTGCTCCTTTGACACCTCGTTCACATCATAACAGCAAGGCTAGAGCTTGTTTGCCACCATTG
CAGCCTCTTGCCATTTCTAGGAGGAGCTTAGACGAGTGGCCTAAGGCGGGTTCGGATGATGTCGGTGAGTGGCCTCATCC
ACCAACACCTAGCGGGAACAAAACCGGGGAGAGATTGAAGCTCGATTTATCATCAACGCAGCAGCGGGTAACAGATAAGA
GCTCTGGTCTAGCTAAGAGGGAGAAGATTGCTTTCTTTGATAAAGAATGTTCAAAGGTTGCTGATCATATATATGTGGGT
GGAGATGCTGTGGCGAAAGACAAGAGCATACTGAAAAACAATGGAATCACGCATATCTTGAACTGCGTTGGTTTTATCTG
TCCGGAATATTTCAAGTCTGATTTTTGTTACAGATCCTTGTGGTTACAGGATAGTCCGTCAGAGGATATAACTAGTATTC
TGTACGATGTGTTTGACTACTTTGAAGATGTGAGGGAGCAAAGTGGAAGGATCTTTGTTCATTGTTGTCAAGGGGTTTCA
CGATCTACCTCGTTGGTAATAGCATATCTGATGTGGAGAGAAGGGCAAAGTTTTGATGATGCATTTCAGTATGTGAAGTC
TGCTAGAGGTATTGCTGATCCTAACATGGGCTTTGCTTGCCAATTGTTACAATGCCAAAAGAGGGTTCATGCGTTCCCGC
TTAGCCCTACCTCCTTACTTAGAATGTACAAAATGTCTCCACACTCTCCTTATGACCCTTTGCATCTTGTTCCAAAACTG
TTGAATGATCCATGCCCGGGTTCTCTGGATTCAAGAGGTGCATTTATCATTCAGTTACCTTCTGCAATTTACATTTGGGT
TGGTAGGCAGTGTGAAACCATCATGGAGAAAGATGCAAAAGCTGCTGTTTGTCAGATTGCTCGATATGAGAAAGTCGAAG
CACCTATTATGGTGGTCAGAGAAGGTGATGAGCCTGTTTATTACTGGGATGCATTTGCAAGCATTTTGCCTATGATTGGG
GGCTCGGTAATTAAAGTTCAACCAGGTGACAGGAAGGTCGACGCATATAATCTGGATTTTGAGATTTTTCAGAAAGCCAT
AGAGGGAGGTTTTGTGCCAACTTTAGCATCATCCAACAACGAACATGAGACTCATCTTCCTGCAAGGGAAAACAGTTGGA
GCTCACTGAAATGTAAGTTTGCATCAAGGTTTGACAAAGGTTTTCGGTATGTCTCCAAAACGCCACTATCTAGGGTCTAT
TCAGATTCGATGATGATCGTGCATTCATCAGGCTCACCTTCCTCAACAACTTCTTCATCATCCACTGCGTCGCCTCCTTT
TCTCTCTCCCGATTCTGTATGTTCAACAAATTCAGGCAATAGCTTAAAGAGTTTCTCTCAATCCTCTGGACGTTCGTCCT
TGAGACCTTCTATTCCACCATCGCTGACATTGCCTAAATTTTCCAGCCTATCCCTCCTCCCTTCCCAAACTTCTCCTAAA
GAATCTCGTGGTGTCAATACTTTTCTTCAACCGTCACCAAATAGAAAGGCTTCACCTTCTCTTGCTGAGCGTAGAGGCAG
CCTGAAAGGATCTCTGAAGTTGCCAGGTTTGGCTGATTCCAACAGAGGCACACCTGCTTTTACTTTACATCCGGATGATA
GTAATGACATAGTCTTCAATCTGGAGGGTATTAGAAACGGCGATCTATATCCACCAAGTGATTGCAAAGGGACAAGTGTA
GATTCAGATTTGCCAGAGAAGGAAATTATATCCTTAATCAGTTGCAGTAAATCTGACAGACACAAATCGGGAGGTGATAC
TGATAGCTCTGGCCAGCCTTTAGCATGTCGTTGGCCAAGTATGGAGATGATTACAAAACTGAGCAGAGCTTACTTAGATT
CAGAATCTGTTATAGCAATCCCGTTGCCAAGTGATGCTGTAGGAGAAACGGGTAGTAGGAATTTGTACATTTGGATCGGA
AAGTCATTCTCTTTGGATAACAACTGTTCTCTAGTAGATAGCAACAAAGCGGCAGACACTGTGGAGAATGTTGATTGGGT
ACAAATTGGTGAATCCATTTTGTGTCAGATGGACTTGCCAAAAGATACCCCTATAAAGATAGTTAGGGAATCTGAGGATC
AGACAGAGTTGCTAGCACTGCTGAGCGCGCTATAA