Details for Arabidopsis Locus AT3G55260

Position : Chr3 ( 5`- 20489248 .. 20493076 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55260

Protein [Map View]
MSTNLLRLILLFITLSITSSLSTPSPADSPPYLWPLPAEFSFGNETLSVDPTVTLIVAGNGGGSLIIRAAFDRYMGIIFK
HASGRGSLLSRIRFLKMVEYDITSLKIVVHSDSEELQLGVDESYTLMVSKKNEQSIVGAATIEANTVYGALRGLETFSQL
CAFDYITKSVQIYKAPWYIQDKPRFGYRGLLIDTSRHYLPIDVIKQIIESMSFAKLNVLHWHIVDEQSFPLETPTYPNLW
KGAYSRWERYTVEDASEIVRFAKMRGINVMAEVDVPGHAESWGTGYPDLWPSLSCREPLDVTKNFTFDVISGILADMRKI
FPFELFHLGGDEVNTDCWKNTTHVKEWLQGRNFTTKDAYKYFVLRAQQIAISKNWTPVNWEETFSSFGKDLDPRTVIQNW
LVSDICQKAVAKGFRCIFSNQGYWYLDHLDVPWEEVYNTEPLNGIEDPSLQKLVIGGEVCMWGETADTSVVLQTIWPRAA
AAAERMWSTREAVSKGNITLTALPRLHYFRCLLNNRGVPAAPVDNFYARRPPLGPGSCYAQ*

DNA
ATGTCAACGAATCTTCTTCGTCTTATTCTCCTATTCATCACTTTATCTATCACTTCATCTCTGTCAACTCCGTCGCCGGC
TGATTCTCCTCCTTATCTATGGCCGTTACCGGCGGAGTTTTCGTTCGGAAACGAAACGCTCTCGGTGGATCCCACCGTGA
CTCTAATCGTAGCTGGAAATGGCGGTGGATCTCTGATTATTAGAGCTGCGTTTGATAGGTATATGGGTATAATCTTTAAA
CACGCTTCTGGTAGAGGTTCTCTATTGTCGAGGATTAGATTTCTGAAAATGGTTGAGTATGATATCACTTCTTTGAAGAT
CGTTGTTCATTCTGATTCTGAGGAGCTTCAATTGGGTGTGGATGAGAGTTATACATTGATGGTGTCGAAGAAGAACGAGC
AATCGATTGTTGGAGCAGCCACGATCGAGGCTAATACAGTTTATGGTGCACTTAGAGGATTGGAGACATTTAGCCAGTTG
TGTGCCTTTGATTATATAACCAAATCTGTGCAAATATATAAAGCACCATGGTATATTCAAGATAAACCTAGATTTGGATA
CCGCGGTCTGCTGATAGATACATCAAGACATTATTTACCAATTGATGTTATTAAGCAAATAATCGAATCCATGTCCTTTG
CCAAACTTAATGTCCTGCATTGGCACATTGTAGACGAGCAATCATTTCCTCTTGAAACTCCTACATATCCTAATTTGTGG
AAAGGAGCTTATTCGAGATGGGAACGTTATACAGTTGAGGATGCCTCTGAGATTGTCAGGTTTGCCAAAATGAGAGGTAT
TAATGTCATGGCTGAAGTAGATGTCCCTGGCCATGCGGAATCGTGGGGAACTGGATACCCTGATCTTTGGCCGTCTCTGT
CTTGCCGAGAGCCCCTTGATGTTACTAAAAACTTTACATTCGATGTGATTTCTGGCATTTTAGCAGATATGAGAAAGATA
TTCCCATTTGAGCTTTTCCACTTGGGTGGTGATGAAGTTAATACAGATTGCTGGAAAAACACAACTCATGTTAAAGAATG
GCTTCAGGGTCGCAACTTCACGACTAAGGACGCATATAAATACTTTGTACTCCGAGCGCAACAGATAGCTATATCGAAAA
ATTGGACACCTGTCAACTGGGAAGAAACCTTCAGTTCCTTTGGAAAAGATCTTGATCCGCGGACTGTGATTCAAAACTGG
CTAGTGTCTGATATATGTCAAAAAGCAGTAGCAAAAGGATTCAGGTGCATTTTCAGTAACCAAGGATATTGGTACCTCGA
CCATTTAGATGTTCCGTGGGAAGAGGTTTATAACACCGAGCCTCTAAATGGAATCGAGGATCCTTCTCTCCAAAAGCTTG
TCATCGGAGGAGAAGTTTGCATGTGGGGTGAAACAGCTGATACATCCGTTGTCCTTCAGACCATTTGGCCTCGTGCTGCA
GCAGCTGCAGAACGGATGTGGAGCACCAGAGAGGCCGTGTCAAAGGGGAACATAACGTTAACCGCATTGCCACGTCTACA
CTACTTCAGATGTCTACTGAATAACCGTGGCGTTCCAGCGGCTCCAGTGGATAACTTTTACGCACGAAGACCCCCCTTGG
GACCTGGCTCTTGCTATGCTCAGTGA