Details for Arabidopsis Locus AT3G55240

Position : Chr3 ( 5`- 20473541 .. 20474763 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55240

Protein [Map View]
MADSSSASYIHMVQHMIEKCLIFHMSKEECVEALSKHANITPVITSTVWKELEKENKEFFKAYEERQSKQEQMSEEETNQ
MIQKIISDSSKESDD*

DNA
ATGGCAGATTCTTCTTCTGCTTCTTACATTCACATGGTGCAGCACATGATAGAGAAATGTTTGATCTTCCATATGAGCAA
AGAAGAGTGTGTGGAAGCTCTCTCTAAGCATGCAAACATCACTCCTGTCATCACCTCTACTGTGTGGAAGGAGCTGGAGA
AAGAGAACAAGGAATTCTTCAAGGCGTATGAGGAGAGGCAAAGCAAACAAGAGCAAATGTCGGAGGAAGAGACAAACCAG
ATGATCCAGAAGATTATCTCGGATTCATCTAAAGAATCCGACGACTGA