Details for Arabidopsis Locus AT3G55200

Position : Chr3 ( 5`- 20460533 .. 20464556 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55200

Protein [Map View]
MYLYSLTLQQATGIVCAINGNFSGGKTQEIAVARGKILDLLRPDENGKIQTIHSVEVFGAIRSLAQFRLTGAQKDYIVVG
SDSGRIVILEYNKEKNVFDKVHQETFGKSGCRRIVPGQYVAVDPKGRAVMIGACEKQKLVYVLNRDTTARLTISSPLEAH
KSHTICYSLCGVDCGFDNPIFAAIELDYSEADQDPTGQAASEAQKHLTFYELDLGLNHVSRKWSNPVDNGANMLVTVPGG
ADGPSGVLVCAENFVIYMNQGHPDVRAVIPRRTDLPAERGVLVVSAAVHKQKTMFFFLIQTEYGDVFKVTLDHNGDHVSE
LKVKYFDTIPVASSICVLKLGFLFSASEFGNHGLYQFQAIGEEPDVESSSSNLMETEEGFQPVFFQPRRLKNLVRIDQVE
SLMPLMDMKVLNIFEEETPQIFSLCGRGPRSSLRILRPGLAITEMAVSQLPGQPSAVWTVKKNVSDEFDAYIVVSFTNAT
LVLSIGEQVEEVNDSGFLDTTPSLAVSLIGDDSLMQVHPNGIRHIREDGRINEWRTPGKRSIVKVGYNRLQVVIALSGGE
LIYFEADMTGQLMEVEKHEMSGDVACLDIAPVPEGRKRSRFLAVGSYDNTVRILSLDPDDCLQILSVQSVSSAPESLLFL
EVQASIGGDDGADHPANLFLNSGLQNGVLFRTVVDMVTGQLSDSRSRFLGLKPPKLFSISVRGRSAMLCLSSRPWLGYIH
RGHFHLTPLSYETLEFAAPFSSDQCAEGVVSVAGDALRIFMIDRLGETFNETVVPLRYTPRKFVLHPKRKLLVIIESDQG
AFTAEEREAARKECFEAGGVGENGNGNADQMENGADDEDKEDPLSDEQYGYPKAESEKWVSCIRVLDPKTATTTCLLELQ
DNEAAYSVCTVNFHDKEYGTLLAVGTVKGMQFWPKKNLVAGFIHIYRFVEDGKSLELLHKTQVEGVPLALCQFQGRLLAG
IGPVLRLYDLGKKRLLRKCENKLFPNTIISIQTYRDRIYVGDIQESFHYCKYRRDENQLYIFADDCVPRWLTASHHVDFD
TMAGADKFGNVYFVRLPQDLSEEIEEDPTGGKIKWEQGKLNGAPNKVDEIVQFHVGDVVTCLQKASMIPGGSESIMYGTV
MGSIGALHAFTSRDDVDFFSHLEMHMRQEYPPLCGRDHMAYRSAYFPVKDVIDGDLCEQFPTLPMDLQRKIADELDRTPA
EILKKLEDARNKII*

DNA
ATGTATCTGTACAGTCTTACTCTGCAGCAGGCGACGGGAATCGTCTGCGCAATCAACGGGAACTTTTCCGGCGGCAAGAC
ACAGGAGATTGCGGTAGCTCGTGGCAAGATTTTGGATCTTCTCCGTCCCGACGAGAACGGTAAGATCCAGACGATACACT
CTGTAGAAGTATTTGGTGCAATTAGATCCCTAGCTCAGTTTAGGTTGACTGGTGCGCAGAAGGATTATATCGTAGTAGGC
TCAGATTCGGGTAGAATTGTTATACTTGAGTACAACAAGGAGAAAAATGTGTTCGATAAAGTTCACCAGGAGACTTTTGG
CAAGTCTGGTTGCAGAAGAATTGTGCCAGGCCAGTACGTGGCTGTTGATCCCAAAGGAAGAGCTGTTATGATTGGAGCTT
GTGAGAAGCAGAAATTGGTTTATGTTTTGAACAGAGATACCACTGCTAGGTTAACTATTTCTTCTCCCTTGGAGGCTCAC
AAGTCTCATACCATTTGCTATTCTCTCTGCGGTGTGGACTGCGGTTTCGATAACCCGATTTTTGCAGCCATTGAGCTTGA
TTACTCCGAGGCAGATCAGGATCCTACTGGCCAAGCCGCTAGTGAGGCTCAGAAGCATTTGACTTTCTATGAGCTCGATT
TGGGGCTCAACCATGTCTCTAGAAAGTGGTCTAACCCTGTTGACAATGGTGCCAATATGCTTGTTACTGTTCCTGGAGGA
GCTGATGGCCCGAGTGGAGTTTTGGTTTGCGCCGAGAATTTTGTTATTTACATGAATCAGGGTCATCCAGACGTGAGGGC
TGTGATTCCTAGACGAACTGATTTGCCTGCTGAACGGGGAGTTTTGGTTGTTTCTGCCGCCGTGCACAAGCAGAAGACAA
TGTTCTTCTTTTTAATCCAGACTGAGTATGGCGACGTTTTTAAGGTCACCTTGGATCACAATGGCGATCATGTCTCCGAG
TTGAAGGTTAAATACTTCGACACCATTCCCGTCGCATCCTCTATATGTGTGTTGAAGCTGGGATTCCTCTTCTCTGCTTC
GGAATTTGGAAACCATGGTTTGTATCAGTTTCAGGCCATAGGAGAGGAACCTGATGTAGAGTCTTCCTCCTCTAATCTGA
TGGAAACCGAAGAAGGTTTTCAGCCCGTCTTTTTTCAGCCTAGACGACTTAAGAATCTTGTTAGGATTGACCAAGTCGAG
AGTCTGATGCCGCTCATGGACATGAAAGTCCTAAACATTTTTGAGGAAGAAACCCCTCAAATCTTTTCACTTTGCGGCCG
GGGTCCACGATCCTCTCTAAGGATACTGAGACCTGGTTTGGCCATCACTGAGATGGCTGTCTCTCAGCTTCCAGGTCAGC
CAAGTGCTGTGTGGACGGTGAAAAAGAATGTGAGCGATGAGTTTGATGCATACATCGTTGTCTCTTTTACCAATGCTACT
CTTGTTCTTTCGATTGGTGAACAAGTTGAAGAAGTTAATGACAGTGGGTTTCTTGATACTACCCCATCCCTGGCTGTCTC
TCTGATCGGCGATGATTCTCTCATGCAAGTCCATCCCAATGGTATCCGCCACATAAGGGAAGATGGACGCATTAACGAAT
GGAGAACTCCTGGCAAGAGGTCAATTGTTAAAGTTGGGTATAATCGGCTTCAAGTGGTCATTGCATTGAGTGGGGGAGAG
CTTATATACTTTGAGGCAGATATGACTGGCCAGCTGATGGAGGTGGAGAAGCATGAAATGTCTGGTGATGTGGCTTGCCT
GGACATTGCCCCTGTTCCTGAAGGAAGAAAAAGGTCTCGCTTTCTTGCTGTGGGATCTTATGATAATACTGTGCGCATTC
TATCTCTGGATCCTGACGACTGTCTGCAGATTCTCAGCGTGCAAAGTGTCTCTTCAGCTCCGGAGTCTCTGCTATTCCTC
GAAGTTCAGGCATCGATTGGTGGAGATGATGGTGCTGATCACCCGGCAAATCTCTTCCTCAATTCTGGGCTGCAGAATGG
TGTTCTTTTCAGAACTGTGGTGGACATGGTGACTGGTCAGCTTTCGGATTCTCGCTCCCGGTTCTTGGGGCTGAAGCCTC
CCAAGCTATTCTCCATTTCTGTGAGAGGCCGGTCTGCAATGCTGTGTTTGTCTAGCCGACCTTGGCTTGGTTATATTCAC
CGAGGACACTTCCATTTGACGCCTCTGTCTTACGAGACTCTGGAATTTGCTGCCCCCTTTTCATCTGATCAGTGCGCTGA
AGGTGTTGTCTCTGTCGCTGGGGATGCTCTGAGAATTTTTATGATTGATCGTCTTGGTGAAACATTCAACGAAACAGTGG
TCCCTCTGAGGTACACGCCTAGAAAGTTTGTTCTCCATCCCAAGCGGAAGTTGTTGGTTATTATCGAGAGTGACCAGGGA
GCATTCACCGCAGAAGAGCGTGAAGCTGCAAGAAAGGAGTGCTTCGAGGCTGGTGGAGTGGGAGAAAATGGCAATGGCAA
TGCAGATCAGATGGAGAATGGTGCGGATGATGAAGATAAGGAAGACCCGCTTTCTGATGAGCAGTACGGTTATCCAAAAG
CAGAGTCTGAAAAGTGGGTCTCTTGCATCAGAGTTCTTGATCCCAAGACAGCTACGACAACTTGTCTCCTGGAACTTCAG
GACAACGAAGCTGCATACAGTGTCTGTACGGTGAATTTCCATGATAAAGAGTATGGTACACTGTTGGCTGTTGGTACGGT
CAAAGGGATGCAGTTCTGGCCCAAGAAGAATCTAGTGGCTGGGTTCATACATATTTATAGGTTTGTGGAGGATGGGAAAT
CTCTTGAGCTTCTTCATAAGACGCAAGTAGAAGGTGTTCCTCTTGCTCTGTGCCAGTTCCAAGGAAGACTGCTGGCAGGG
ATCGGACCTGTCCTCAGATTGTATGATTTGGGGAAAAAGAGACTGCTTAGGAAATGTGAAAACAAGCTCTTTCCAAACAC
CATTATCTCTATCCAAACTTACCGTGACCGTATATACGTTGGTGACATTCAGGAGTCTTTCCATTACTGCAAGTACAGGC
GCGACGAGAATCAGCTGTACATATTTGCGGATGACTGCGTGCCGAGGTGGCTGACAGCATCGCACCATGTGGATTTCGAT
ACCATGGCAGGTGCAGATAAGTTTGGGAATGTGTATTTTGTGCGGTTGCCTCAGGATCTGTCGGAGGAGATAGAAGAAGA
CCCGACTGGCGGGAAGATCAAGTGGGAGCAAGGAAAGCTGAATGGAGCACCGAACAAAGTGGATGAGATAGTACAGTTCC
ATGTTGGGGACGTTGTGACGTGCTTGCAGAAAGCTTCGATGATCCCAGGTGGATCGGAATCGATAATGTATGGAACAGTG
ATGGGTAGCATAGGGGCATTACATGCTTTCACATCCCGTGATGATGTGGATTTCTTCTCTCATCTGGAGATGCACATGAG
GCAGGAGTATCCTCCTCTCTGCGGGAGAGACCACATGGCTTACAGATCTGCATATTTTCCGGTCAAGGACGTGATAGATG
GAGATCTGTGTGAGCAGTTCCCGACACTCCCAATGGACTTGCAGAGGAAAATAGCAGACGAGCTGGATAGAACACCTGCG
GAGATTCTGAAGAAGCTCGAAGACGCAAGGAACAAGATCATTTGA