Details for Arabidopsis Locus AT3G55120

Position : Chr3 ( 5`- 20430114 .. 20431470 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55120

Protein [Map View]
MSSSNACASPSPFPAVTKLHVDSVTFVPSVKSPASSNPLFLGGAGVRGLDIQGKFVIFTVIGVYLEGNAVPSLSVKWKGK
TTEELTESIPFFREIVTGAFEKFIKVTMKLPLTGQQYSEKVTENCVAIWKQLGLYTDCEAKAVEKFLEIFKEETFPPGSS
ILFALSPTGSLTVAFSKDDSIPETGIAVIENKLLAEAVLESIIGKNGVSPGTRLSVAERLSQLMMKNKDEKEVSDHSVEE
KLAKEN*

DNA
ATGTCTTCATCCAACGCCTGCGCCTCTCCGTCACCGTTCCCCGCCGTCACGAAGCTTCATGTAGACTCCGTCACGTTTGT
ACCGTCCGTCAAGTCACCGGCCTCCTCCAATCCATTATTCCTCGGCGGCGCCGGTGTCCGAGGCCTTGATATCCAAGGTA
AATTCGTGATCTTCACCGTCATTGGAGTATACCTAGAGGGTAACGCCGTTCCTTCTCTATCTGTCAAGTGGAAGGGAAAA
ACTACGGAGGAGCTAACAGAATCTATCCCGTTCTTCCGTGAAATAGTCACCGGTGCGTTTGAGAAGTTTATCAAGGTGAC
AATGAAACTGCCGTTAACGGGACAACAATATTCGGAGAAAGTGACGGAGAATTGTGTGGCTATATGGAAACAATTAGGGC
TTTATACGGACTGTGAAGCTAAAGCTGTGGAGAAGTTCTTGGAGATCTTCAAGGAAGAAACATTCCCTCCCGGTTCATCG
ATCCTCTTCGCTCTCTCCCCTACCGGCTCTCTTACGGTTGCGTTTTCGAAAGATGATAGTATCCCTGAAACCGGGATCGC
TGTGATCGAGAACAAATTGTTGGCGGAGGCGGTTCTGGAATCTATCATCGGGAAGAACGGTGTGTCACCTGGCACTAGGT
TAAGTGTTGCAGAAAGATTATCTCAGCTAATGATGAAGAACAAGGACGAAAAGGAAGTTAGTGATCACTCTGTTGAGGAA
AAACTAGCCAAAGAGAACTGA