Details for Arabidopsis Locus AT3G55070

Position : Chr3 ( 5`- 20408286 .. 20411140 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55070

Protein [Map View]
MEIDSATNGNSDTVMTESAATITPSPVVVSSSRSNQFTESLKLEHQLLRVPFEHYKKTIRTNHRSFEKEVSTIVNGVGEL
ADSDWSKDDTVSRLTCLVTRLQGLKRKLEEGSNVENLQAQRCRARIDHLDSVDVENITEWNNTKLKRILVDYMLRMSYFE
TATKLSESSNIMDLVDIDIFREAKKVIDALKNREVASALTWCADNKTRLKKSKSKFEFQLRLQEFIELVRVDTAESYKKA
IQYARKHLASWGTTHMKELQHVLATLAFKSTTECSKYKVLFELRQWDVLVDQFKQEFCKLYGMTMEPLLNIYLQAGLSAL
KTPYGLEEGCTKEDPLSQENFRKLALPLPFSKQHHSKLVCYISKELMDTENPPQVLPNGYVYSTKALKEMAEKNGGKITC
PRTGLVCNYTELVKAYIS*

DNA
ATGGAAATCGATTCCGCCACCAACGGAAACTCTGACACCGTCATGACGGAATCCGCCGCTACGATCACTCCGTCGCCGGT
CGTCGTCTCGTCTTCGAGATCGAATCAATTTACGGAATCTCTCAAGCTTGAGCACCAGCTCCTCCGCGTTCCTTTCGAGC
ATTACAAGAAGACGATCCGTACCAATCACCGTTCTTTCGAGAAAGAGGTCTCAACCATTGTTAACGGCGTCGGAGAATTG
GCTGATTCCGATTGGTCTAAAGACGATACCGTTTCGCGTCTTACTTGCCTTGTTACTCGATTACAAGGCCTCAAACGAAA
GTTGGAAGAAGGGAGCAATGTGGAGAATTTGCAAGCCCAGAGATGTCGTGCTCGCATCGATCATTTGGATTCAGTAGATG
TGGAAAATATTACTGAATGGAATAATACCAAACTGAAACGGATTCTTGTAGACTACATGCTGCGGATGTCATATTTCGAG
ACTGCTACAAAGCTTTCGGAAAGCAGCAATATTATGGACCTTGTCGACATTGACATATTTCGAGAAGCTAAGAAGGTGAT
TGATGCCCTTAAAAATAGGGAGGTAGCTTCTGCATTGACATGGTGTGCTGATAACAAAACGCGGTTGAAAAAGTCAAAGA
GCAAATTTGAGTTCCAACTAAGGCTGCAAGAATTCATCGAGTTGGTACGAGTTGATACAGCTGAGAGCTACAAAAAAGCA
ATCCAGTATGCTCGAAAGCATCTGGCATCATGGGGAACAACCCATATGAAAGAATTGCAGCATGTTCTGGCCACTTTGGC
TTTTAAAAGTACCACAGAATGCTCAAAATATAAGGTTTTGTTTGAACTACGACAGTGGGATGTTTTAGTTGATCAGTTTA
AACAAGAATTTTGCAAGTTATATGGCATGACGATGGAACCCTTATTGAACATCTACTTACAGGCAGGCTTGTCTGCGCTG
AAAACTCCATATGGTTTAGAAGAAGGTTGTACCAAAGAGGACCCTCTCTCACAAGAGAACTTTCGGAAGCTAGCTTTGCC
TTTACCGTTCTCCAAGCAGCACCATTCAAAGCTTGTTTGCTATATTTCTAAGGAGCTAATGGACACAGAGAACCCACCAC
AGGTGCTGCCCAATGGCTACGTCTACAGCACCAAGGCTCTCAAGGAAATGGCGGAAAAGAATGGAGGTAAAATAACATGT
CCAAGGACAGGGCTTGTCTGCAACTACACGGAGTTAGTTAAGGCATATATATCATGA