Details for Arabidopsis Locus AT3G55060

Position : Chr3 ( 5`- 20402984 .. 20407046 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55060

Protein [Map View]
MKKLFFFRSSGNGNDKQVNCEKEADSKMRTQASSQAEQEFDSPKSHGQVSGGLALRRSLSWSSAGFLFDKFGETSKNELT
TSATKSKDRRRNHSSRCFTPERQVRERQCKADKFQHDSSGSSSSCSSNVSSKVLDRYIDGEEHLEPCKQKSNSSHSGVSE
SINRRRLPPRVQWTVPTSPSDTFDEKRKSQSFREAKGTHLRYSSADCVDNGLRHGSPRSVARNVIERLSQTHGKSKGSNH
EPITIQDVYGGSLNRTFDSSSDIAANVSLAEHYEPVNEYYTQDYGGHQQNCIRSRNVYKCMEDDLDSELEMKIKEAEKRA
KLFSAELEQQRCLSDCDFDVSSLVGAIRKLEDERLHLAFENVNLLRSQIVERASAREEIRWLKSDWDLHIQRLEKEKSEL
QAGLEKELDRRSGEWTSKLEKFQLEEKKLRERVRELAEHNVSLQRELSAFHENETENKDMITHLERRVAELTTTADKLHE
ENNYVKQTLSKLQESYAGATEDLDFLRRNFEEKDQECRELHKSVTKFFRTCKEQGKTIEGLRDGVSEEVKKQPSEKLDQL
VKKLQVEQVRLTGIELSLRREVESMKLETDSLRHENICLLNRLKGNGQEIDITTLKLENELKMRVCYLQEQGLSMLNESS
QLCYKLLKFIKGKLTQLPETYQDKNSVKDGLSEQFMIESEMKVHGIRRGTENLKRSLQTVTSVVASNSESSSSNTGRPRE
QRNQSVEENLRAELSAETLITSLVREKLYSKEKEIEQLQAELAAAVRGNEILRCEVQSSLDNLSVTTHELKDLKHQMLKK
EESIRRLESNLQEAAKEMARLNALLSKVSNERGQIWSEYKQYGEKNMLLNSENETLKGMVEKLEEKVLEKEGEITILQDT
IGSKHLNLLSSPDFLV*

DNA
ATGAAAAAGCTCTTCTTTTTCAGATCTTCTGGTAATGGAAATGATAAACAAGTTAACTGCGAAAAAGAAGCGGATAGTAA
GATGAGAACCCAAGCTAGTAGTCAGGCTGAACAAGAGTTCGATAGTCCTAAGTCACATGGTCAAGTTTCTGGTGGTCTAG
CTCTTAGACGAAGCCTTTCATGGTCCTCTGCAGGTTTCCTTTTTGACAAGTTTGGAGAAACTTCCAAGAATGAACTAACA
ACTAGTGCTACTAAAAGCAAGGATAGGCGGCGCAATCATTCATCTCGATGCTTTACTCCAGAAAGACAAGTTAGAGAAAG
GCAGTGTAAAGCAGACAAGTTTCAGCATGATTCGTCTGGGAGTTCATCATCTTGTTCGAGTAATGTCTCTAGTAAAGTTC
TGGACCGTTATATTGATGGAGAAGAGCATTTGGAACCGTGCAAGCAAAAGAGTAATTCTTCACACAGTGGTGTTTCTGAG
AGTATAAATCGAAGGAGGCTTCCACCCCGAGTTCAATGGACAGTCCCTACATCACCATCAGACACTTTCGATGAGAAACG
AAAGTCCCAGTCATTTAGAGAAGCTAAAGGCACCCATTTACGTTACTCTTCTGCTGATTGTGTGGATAATGGGTTGCGGC
ATGGATCGCCTCGTTCGGTTGCTAGAAATGTCATTGAAAGACTCTCTCAGACTCATGGCAAGTCAAAGGGTTCAAACCAC
GAACCAATCACAATTCAAGATGTCTATGGTGGATCCCTTAACAGAACTTTTGACTCGAGCTCAGATATCGCCGCTAATGT
TTCACTAGCTGAACATTATGAACCTGTTAACGAGTATTATACGCAGGACTATGGAGGGCACCAGCAAAATTGTATACGGA
GTAGGAACGTGTACAAGTGTATGGAAGACGATCTTGACTCCGAGCTAGAAATGAAAATTAAAGAAGCTGAGAAGAGAGCT
AAATTGTTTTCTGCAGAATTGGAGCAGCAGAGATGCCTTTCAGACTGTGACTTCGATGTTTCATCTTTGGTTGGGGCAAT
TAGAAAACTGGAAGATGAGAGGCTCCACTTGGCATTTGAGAATGTAAATCTCTTACGGTCCCAAATAGTTGAGAGGGCTT
CTGCTAGGGAAGAAATCAGATGGTTGAAGTCAGATTGGGACTTGCATATACAGAGACTAGAAAAGGAGAAGAGCGAGCTG
CAGGCTGGATTGGAGAAAGAGCTTGATAGAAGATCAGGTGAGTGGACGTCAAAACTCGAAAAATTCCAGCTTGAAGAGAA
GAAGCTCCGAGAGCGTGTAAGAGAGCTTGCTGAGCATAATGTCTCACTCCAGAGAGAACTATCTGCTTTCCACGAAAATG
AGACAGAGAACAAAGACATGATAACACATTTGGAGAGAAGAGTTGCTGAGCTGACCACAACAGCAGATAAATTGCATGAA
GAGAACAATTATGTTAAACAAACTCTCTCCAAGTTACAAGAGAGTTACGCAGGTGCTACAGAAGATCTTGATTTCTTGAG
AAGAAACTTTGAAGAGAAGGATCAAGAATGCAGGGAGTTGCACAAATCTGTTACAAAGTTTTTCAGAACTTGCAAAGAAC
AAGGGAAGACAATTGAGGGACTTCGAGATGGTGTTTCTGAGGAGGTTAAGAAGCAACCGTCAGAGAAATTAGACCAGTTG
GTCAAGAAATTGCAGGTCGAGCAGGTAAGGTTGACAGGGATCGAGCTTTCACTTAGAAGGGAAGTAGAATCAATGAAGCT
TGAAACTGACTCTCTTCGCCATGAAAATATCTGTCTACTGAATCGATTGAAAGGGAATGGTCAAGAAATAGACATTACAA
CCCTTAAGCTAGAGAATGAGTTGAAGATGCGTGTCTGCTACTTGCAAGAACAGGGACTGTCAATGTTAAATGAGAGCAGC
CAGCTGTGTTACAAGTTACTGAAGTTCATCAAAGGGAAATTAACTCAGCTTCCTGAAACCTATCAGGATAAGAATTCAGT
GAAGGACGGATTAAGTGAGCAGTTTATGATTGAGTCTGAAATGAAAGTCCATGGGATAAGGCGCGGAACTGAAAACCTGA
AGAGGAGTTTGCAAACGGTGACCAGTGTGGTAGCTTCGAATTCAGAATCGTCTTCCTCAAATACTGGTAGGCCTAGGGAA
CAAAGAAACCAATCAGTTGAAGAAAACTTGCGAGCAGAACTGAGTGCTGAGACCCTAATCACAAGTTTAGTGCGGGAGAA
ACTGTATTCCAAGGAAAAGGAAATCGAACAGCTCCAAGCAGAACTAGCAGCAGCAGTACGAGGTAATGAGATTCTGAGAT
GTGAGGTCCAAAGCAGTTTAGACAACCTATCAGTTACAACCCACGAACTGAAAGACCTCAAGCATCAGATGTTGAAGAAG
GAGGAAAGCATAAGACGGCTCGAAAGCAATCTCCAGGAAGCGGCGAAAGAAATGGCGAGGCTGAACGCACTATTGTCAAA
AGTGTCTAATGAAAGAGGCCAGATATGGAGTGAGTATAAACAATACGGTGAGAAAAACATGCTTTTGAACTCAGAGAACG
AGACATTGAAAGGAATGGTAGAGAAATTGGAGGAGAAGGTATTAGAGAAAGAAGGAGAGATCACAATACTACAAGACACA
ATCGGAAGCAAGCATCTGAATCTCCTCTCAAGTCCTGATTTCTTGGTATAA