Details for Arabidopsis Locus AT3G55000

Position : Chr3 ( 5`- 20381508 .. 20383789 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G55000

Protein [Map View]
MDDYTREMMDLKTLVTRTLEKKGVLAKIRAELRASVFEAIEEEDRVIENNEGPPPALLGSCNDRARKLHASPSGRLLSAL
ICEYLDWAQLNHTLIVYQPESNLPKDSWKSELRDFNSNNGFELNRNGDSGPLLLDVLEGFLKFESMTQGMGSSSRRDSET
ESSSSLESRNPPRRSSASDSLPPQRRPVSASQASDRRAGLSTSGYRKDEFNWRQGNQDTHEEVTRASAALENLQLDRKTR
NLTSSWRNVRDGTNEEEGRD*

DNA
ATGGACGATTATACAAGAGAGATGATGGATCTCAAGACTTTGGTCACTCGAACCCTAGAGAAGAAAGGTGTCCTCGCTAA
GATCCGGGCTGAGCTCCGTGCAAGTGTGTTTGAAGCAATTGAAGAAGAGGATAGAGTGATAGAGAACAATGAAGGACCGC
CTCCAGCTCTGTTGGGAAGCTGTAATGATCGTGCAAGGAAGCTTCATGCTTCTCCTTCAGGAAGGTTACTATCTGCGTTG
ATTTGTGAATACTTGGACTGGGCACAACTTAATCACACGCTCATAGTTTATCAACCTGAAAGCAATTTGCCAAAAGATTC
GTGGAAGTCTGAGTTACGCGACTTTAATAGCAACAATGGTTTTGAGCTCAATAGAAATGGAGATAGTGGACCACTCCTTC
TCGATGTTCTTGAAGGGTTCTTGAAGTTTGAGAGCATGACGCAGGGCATGGGTAGTAGTTCAAGGAGAGATTCAGAAACA
GAGTCGTCATCAAGCCTTGAGTCCAGAAATCCTCCTCGCAGATCATCTGCTTCTGATAGCTTACCTCCTCAACGAAGGCC
GGTTTCTGCATCTCAAGCATCGGATAGAAGAGCCGGGTTGTCTACATCTGGGTACAGAAAAGATGAATTCAACTGGAGAC
AAGGTAACCAAGATACACATGAAGAGGTAACAAGAGCTTCAGCGGCGCTGGAAAATCTACAGCTTGATAGGAAAACTCGG
AACTTAACATCGTCTTGGAGGAATGTGAGGGATGGAACAAATGAAGAAGAAGGGAGAGATTGA