Details for Arabidopsis Locus AT3G54990

Position : Chr3 ( 5`- 20373718 .. 20376522 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G54990

Protein [Map View]
MLDLNLKIFSSYNEDQDRKVPLMISTTGEEESNSSSSSTTDSAARDAFIAFGILKRDDDLVPPPPPPPHKETGDLFPVVA
DARRNIEFSVEDSHWLNLSSLQRNTQKMVKKSRRGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLGGFDTAYAAARA
YDRAAIKFRGLDADINFVVDDYRHDIDKMKNLNKVEFVQTLRRESASFGRGSSKYKGLALQKCTQFKTHDQIHLFQNRGW
DAAAIKYNELGKGEGAMKFGAHIKGNGHNDLELSLGISSSSESIKLTTGDYYKGINRSTMGLYGKQSSIFLPMATMKPLK
TVAASSGFPFISMTSSSSSMSNCFDP*

DNA
ATGTTGGATCTTAACCTAAAGATCTTTTCTTCTTATAACGAAGATCAAGATCGGAAAGTACCATTAATGATCTCAACCAC
CGGTGAAGAAGAATCTAACTCATCTTCCTCCTCCACAACAGACTCTGCAGCGAGAGATGCTTTCATCGCTTTTGGAATTC
TCAAACGCGACGATGACCTTGTTCCTCCTCCTCCTCCTCCTCCTCATAAAGAAACAGGAGATCTCTTTCCGGTGGTGGCT
GATGCTCGTCGGAATATAGAATTCTCCGTGGAAGACAGTCACTGGTTGAATCTTTCTTCTTTACAAAGAAATACACAGAA
AATGGTGAAGAAGAGCAGAAGAGGACCAAGGTCTCGTAGCTCCCAATATCGTGGCGTCACTTTTTACCGTCGCACCGGTC
GTTGGGAATCTCATATTTGGGATTGTGGAAAGCAAGTTTATTTGGGCGGGTTTGATACTGCTTACGCAGCAGCAAGGGCT
TACGACCGAGCTGCTATCAAATTCCGTGGTCTCGATGCAGACATCAATTTCGTCGTGGATGATTATAGGCATGACATCGA
TAAGATGAAGAATTTAAATAAGGTGGAGTTCGTGCAAACACTTAGGCGAGAGAGTGCGAGTTTCGGAAGAGGAAGTTCCA
AATACAAAGGCTTGGCTCTTCAAAAATGCACCCAATTCAAAACTCATGATCAGATTCATCTCTTCCAAAACAGGGGATGG
GATGCAGCAGCAATAAAATACAATGAGTTGGGAAAGGGAGAAGGAGCCATGAAGTTTGGTGCCCATATCAAAGGAAATGG
TCACAATGATCTTGAACTAAGTCTCGGAATTTCATCATCATCGGAAAGTATAAAGTTGACAACAGGCGATTACTATAAGG
GTATCAATCGGTCCACGATGGGTTTATACGGTAAGCAATCATCGATATTTTTACCCATGGCAACCATGAAACCTCTGAAG
ACAGTTGCAGCATCATCAGGATTCCCTTTTATCAGCATGACAAGTTCCTCTTCCTCCATGTCCAATTGTTTTGATCCATA
G