Details for Arabidopsis Locus AT3G54970

Position : Chr3 ( 5`- 20368168 .. 20370098 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G54970

Protein [Map View]
MSNCRFLYHNGVVLEAPPVTTFLESHTGAYTTTRTINNGTSFLFWERHMKRLSSSIRILLKSNPELLFSSGSSPRFWMNQ
PVPGSSIYDRVNGSMSEALKSVVVKESERLYGEELAVTVLVTGNVEKLNRLDVGNNWDFLDVWLHIGAYSPLGPLGVGEN
AASLALVGRGRDVAAAKYSDWVRLRKPLEKFRPPLTTELLLSNDGDHLLEGCITNFFVVCRRVKSSENLYGGSLSEFEVQ
TAPITDGVLAGVIRDLVIEVCLSEGIPYRERAPSWSERELWEEAFITSSLRILQHVGTIKVPVGSMEGLACNKPEEIQWK
EKRFKERPGMITELIKKAIMERGIKEGFPLKAF*

DNA
ATGTCGAATTGCAGATTTCTCTACCACAACGGTGTCGTTTTGGAGGCTCCTCCGGTCACTACCTTCCTTGAATCGCACAC
GGGTGCTTATACAACGACGAGAACGATAAACAATGGTACTAGTTTCTTGTTCTGGGAGAGACACATGAAGAGACTTTCTA
GCTCGATTCGTATTCTTTTGAAGTCAAATCCCGAGCTTTTGTTCAGTTCTGGGTCATCACCGCGGTTTTGGATGAATCAA
CCAGTTCCTGGTTCGAGTATTTACGATCGAGTCAATGGCTCTATGAGCGAGGCCCTGAAGTCTGTTGTTGTCAAGGAAAG
TGAAAGACTCTATGGAGAAGAATTAGCAGTAACTGTTCTTGTTACTGGTAATGTGGAGAAATTGAATAGGTTAGATGTTG
GGAACAATTGGGATTTTCTAGATGTGTGGTTGCATATAGGTGCATACTCGCCTTTAGGCCCGTTAGGTGTTGGAGAAAAT
GCCGCGAGTTTGGCTTTGGTTGGTCGTGGACGAGATGTAGCTGCTGCTAAATACTCAGACTGGGTTAGGCTTAGGAAGCC
TCTGGAGAAGTTTAGACCTCCTTTGACCACTGAACTTCTTTTGTCAAACGATGGTGATCATTTGCTTGAGGGCTGCATCA
CAAACTTTTTCGTAGTTTGCCGCAGGGTGAAGTCATCAGAGAATCTCTACGGCGGGAGTTTGAGCGAGTTTGAGGTGCAG
ACCGCGCCTATAACTGATGGTGTGCTAGCAGGAGTTATAAGAGACCTTGTCATCGAAGTGTGTTTAAGCGAGGGGATTCC
ATACCGCGAGAGAGCACCTTCGTGGTCTGAGCGTGAGCTTTGGGAAGAAGCCTTCATTACAAGTAGTCTGAGGATTTTGC
AGCATGTAGGGACGATCAAAGTACCCGTTGGTTCAATGGAGGGATTGGCTTGTAACAAACCTGAGGAGATTCAATGGAAG
GAGAAAAGGTTTAAGGAAAGACCTGGGATGATCACTGAATTAATCAAGAAAGCGATAATGGAGAGAGGTATTAAAGAAGG
GTTCCCGTTGAAGGCCTTTTAG