Details for Arabidopsis Locus AT3G54950

Position : Chr3 ( 5`- 20358896 .. 20361233 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G54950

Protein [Map View]
MHRVRNKPVKSTATASVKHLIKQRGGDGATAASKSANDYNNNDSLLTDMQEPSIDTDKLSYEIFSILESKFLFGYDDSKP
EPANSVVAGSIKNQRGKICILSIDGGGMRGILPGKALAYLEHALKSKSGDPNARIADYFDVAAGSGIGGIYTAMLFGSRD
GNRPIFKADDTWQFLTRNAKGLYGGAGILKRVLRTGSGCCSGTAKLKKVMKESFSELTLKDTLKPVLIPCYDLKSSGPFL
FSRADALETDGYDFRLSEVCRATWAEPGVFEPVEMKSVDGQTKCVAVGGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDL
LVLSLGMGQLLDVSYEYDRIIKWKAKHWARPAALISNDGAADTVDQAVAMAFGHCRSSNYVRIQANGSNLGPWSPNMDTD
PSGSNVNMLMGVAEEMLKQKNVESVLFGGKRIDEQSNFEKLDWLAGELVLEHQRRNSRIAPTVAFKQSVHRADQKTSDKD
IGVTARER*

DNA
ATGCATAGAGTACGCAATAAACCGGTTAAATCCACCGCTACTGCTTCCGTCAAGCATTTAATCAAACAGAGAGGCGGCGA
CGGAGCTACGGCGGCTTCCAAGTCGGCGAATGATTATAATAATAATGATAGTCTCTTGACGGATATGCAGGAACCAAGCA
TCGATACAGATAAACTCAGCTACGAGATTTTCTCTATTCTTGAGAGCAAATTTCTTTTCGGGTACGACGACTCGAAACCC
GAACCCGCGAATTCGGTTGTTGCTGGGTCGATTAAGAACCAGAGAGGTAAAATCTGTATTCTGAGTATCGATGGAGGTGG
AATGAGAGGGATCTTACCCGGTAAGGCTTTGGCTTATCTAGAACACGCTCTGAAATCTAAATCGGGTGACCCGAATGCCC
GAATCGCCGATTACTTTGACGTAGCCGCCGGGTCCGGTATAGGTGGGATTTACACAGCCATGTTGTTCGGGTCAAGAGAC
GGTAACCGCCCCATCTTCAAAGCAGATGACACGTGGCAGTTCTTAACGAGAAACGCCAAGGGTCTTTACGGAGGAGCAGG
AATCTTGAAACGGGTCTTGAGAACCGGGTCGGGTTGTTGTTCCGGGACGGCTAAGTTAAAGAAAGTGATGAAAGAGTCTT
TCTCGGAGCTAACCTTAAAGGACACGCTTAAACCGGTGCTTATACCTTGCTACGACCTCAAAAGCTCTGGCCCGTTTCTG
TTCTCACGGGCCGATGCGCTTGAGACGGACGGCTATGATTTTAGGCTCTCGGAGGTTTGTAGAGCGACTTGGGCTGAGCC
GGGTGTGTTTGAGCCCGTGGAGATGAAGTCGGTTGATGGGCAGACCAAGTGTGTGGCTGTTGGTGGAGGATTAGCCATGA
GCAATCCCACAGCGGCTGCAATCACGCATGTCCTGCACAACAAGCAGGAGTTTCCGTTTGTGCGAGGTGTTGAGGATTTG
CTTGTGTTGTCTCTTGGTATGGGTCAGTTGCTTGATGTTAGCTATGAGTATGATCGGATTATCAAGTGGAAGGCTAAGCA
TTGGGCTCGCCCCGCAGCTCTTATTTCTAATGACGGTGCTGCTGACACTGTCGATCAAGCTGTGGCCATGGCTTTTGGTC
ACTGCCGCAGTAGTAACTATGTCCGGATTCAGGCGAATGGGTCGAACTTAGGACCTTGGAGTCCTAACATGGACACAGAC
CCTAGTGGGAGCAATGTGAATATGCTGATGGGAGTAGCAGAGGAGATGCTTAAACAAAAGAATGTTGAATCTGTTTTGTT
TGGAGGTAAAAGAATCGATGAACAGAGCAACTTCGAGAAGCTTGACTGGTTAGCTGGGGAACTTGTTCTCGAGCATCAAA
GGAGAAATAGCAGAATCGCTCCAACCGTAGCGTTCAAGCAATCCGTGCATAGAGCAGATCAAAAGACAAGTGATAAAGAT
ATCGGTGTGACCGCAAGAGAACGATGA