Details for Arabidopsis Locus AT3G54826

Position : Chr3 ( 5`- 20310327 .. 20311821 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G54826

Protein [Map View]
MIKKASFIVLRFQNFTENRSVEFLLSLRLSMAARLLALRRALSLFSNQQHRFPLSQVSTEQLSLSNSLFSRSHVYGRLFQ
RQLSVIREANEASVTNVCNSSNSATESAKVPSPATPSEEMMVKYKSQLKINPRHDFMMVFTCKVCDTRSMKMASRESYEN
GVVVVRCGGCDNLHLIADRRGWFGEPGSVEDFLASQGEEFKKGSMDSLNLTPEDLAGGKISTE*

DNA
ATGATTAAAAAGGCTTCTTTTATTGTGCTCCGATTCCAAAATTTCACGGAAAATAGAAGCGTCGAGTTCCTCCTCTCCCT
CAGGTTGTCAATGGCCGCTAGGTTACTTGCTTTGAGACGCGCTTTGTCTCTTTTCAGCAACCAACAACATCGTTTTCCTT
TGTCTCAAGTCTCAACAGAGCAGTTGTCGCTATCAAACTCACTCTTCAGCAGAAGTCATGTTTATGGAAGATTATTTCAG
AGACAGTTATCTGTAATCCGTGAGGCAAATGAAGCTTCTGTAACCAATGTCTGCAACTCGTCAAACTCTGCTACTGAATC
GGCCAAAGTTCCCTCCCCTGCGACGCCCTCTGAGGAAATGATGGTGAAGTACAAGTCCCAGTTAAAAATAAACCCGAGGC
ATGACTTCATGATGGTCTTCACTTGCAAGGTCTGTGATACAAGATCTATGAAGATGGCGAGCCGAGAATCATATGAAAAC
GGCGTTGTGGTGGTACGATGTGGAGGGTGTGATAATCTACATTTGATTGCAGACCGTCGTGGTTGGTTTGGAGAACCAGG
AAGCGTGGAGGACTTCCTTGCTTCTCAAGGGGAAGAATTCAAGAAAGGATCCATGGATTCTCTTAACCTAACTCCTGAAG
ATTTAGCTGGAGGAAAGATTTCTACTGAATAA