Details for Arabidopsis Locus AT3G54790

Position : Chr3 ( 5`- 20281535 .. 20285126 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G54790

Protein [Map View]
MDPVPVRCLLNSISRYLHLVACQTIRFNPIQTCIGNMVLLLKLLKPLLDEVVDCKIPSDDCLYKGCEDLDSVVNQAREFL
EDWSPKLSKLFGVFQCEVLLGKVQTCSLEISRILLQLSQSSPVTSSVQSVERCVQETESFKQEGTLMELMENALRNQKDD
ITSLDNNHLESIIQMLGLISNQDLLKESITVEKERIRSQASKSEEDMEQTEQLIELVLCIREHMLKTEFLEVAKGISIPP
YFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLAVCPRTRQVLTHQELIPNYTVKAMIASWLEANRINLATNSCHQY
DGGDASSMANNMGSQDFNRTESFRFSLRSSSLTSRSSLETGNGFEKLKINVSASLCGESQSKDLEIFELLSPGQSYTHSR
SESVCSVVSSVDYVPSVTHETESILGNHQSSSEMSPKKNLESSNNVNHEHSAAKTYECSVHDLDDSGTMTTSHTIKLVED
LKSGSNKVKTAAAAEIRHLTINSIENRVHIGRCGAITPLLSLLYSEEKLTQEHAVTALLNLSISELNKAMIVEVGAIEPL
VHVLNTGNDRAKENSAASLFSLSVLQVNRERIGQSNAAIQALVNLLGKGTFRGKKDAASALFNLSITHDNKARIVQAKAV
KYLVELLDPDLEMVDKAVALLANLSAVGEGRQAIVREGGIPLLVETVDLGSQRGKENAASVLLQLCLNSPKFCTLVLQEG
AIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKGRS*

DNA
ATGGATCCTGTTCCTGTTCGATGTCTTCTTAACAGTATATCTCGGTATCTTCATCTGGTTGCGTGCCAGACTATAAGATT
TAATCCTATTCAAACATGTATTGGAAATATGGTTCTCTTGTTGAAGCTCTTGAAACCGTTGCTCGATGAAGTTGTTGATT
GCAAGATACCTTCTGATGACTGTTTATATAAAGGATGTGAAGACCTTGATTCTGTTGTTAACCAGGCTCGGGAGTTCTTA
GAGGACTGGTCACCAAAGTTGAGCAAGTTGTTTGGTGTGTTTCAATGCGAGGTTTTGTTGGGAAAGGTCCAGACTTGTTC
GTTGGAGATTAGTCGCATACTTCTTCAGTTATCACAGTCAAGTCCGGTTACTTCAAGCGTACAAAGTGTTGAGCGCTGCG
TGCAGGAGACTGAGAGTTTTAAGCAAGAGGGGACATTAATGGAACTCATGGAGAATGCTTTACGGAATCAGAAAGATGAT
ATTACCTCTTTGGATAACAATCATCTGGAAAGCATAATTCAAATGCTTGGATTGATATCAAACCAAGATCTCTTAAAGGA
AAGCATTACTGTGGAGAAAGAGAGGATAAGATCCCAGGCCAGTAAGTCAGAAGAAGATATGGAACAAACCGAACAGTTGA
TAGAACTCGTCTTGTGCATCCGTGAACACATGCTTAAAACTGAGTTTCTTGAAGTGGCTAAAGGTATCTCGATACCCCCG
TATTTCCGGTGTCCTTTGTCAACAGAACTCATGCTGGATCCGGTAATAGTAGCTTCAGGACAGACATTTGACAGAACATC
CATTAAGAAATGGCTTGATAACGGGTTAGCTGTTTGTCCAAGGACGCGGCAGGTGCTGACTCATCAAGAACTCATTCCCA
ATTACACGGTTAAGGCTATGATAGCGAGTTGGTTGGAGGCAAACAGGATCAACCTTGCTACTAACTCTTGTCATCAGTAT
GATGGTGGTGATGCTTCATCCATGGCTAATAATATGGGTTCTCAAGACTTTAACCGCACCGAGAGTTTTCGTTTTTCTTT
ACGGAGCAGCAGTTTAACCTCAAGATCATCTCTTGAAACTGGAAATGGGTTTGAGAAACTGAAGATTAACGTGTCTGCCA
GTTTATGCGGGGAATCTCAAAGCAAGGATCTTGAAATATTCGAGCTTTTGTCTCCGGGGCAGTCTTACACTCACAGCAGG
AGTGAATCAGTTTGCAGTGTTGTCTCGTCTGTTGATTATGTACCTTCGGTGACACATGAGACAGAAAGTATACTAGGGAA
TCACCAAAGCTCCAGTGAGATGTCTCCCAAGAAAAACTTAGAAAGTTCAAACAATGTAAATCATGAGCATAGCGCAGCAA
AGACTTATGAGTGTTCTGTACATGATTTAGATGATTCAGGAACAATGACGACTTCACATACCATAAAATTGGTAGAAGAT
CTTAAAAGCGGGTCTAACAAAGTGAAGACTGCTGCTGCAGCTGAAATACGTCATCTCACCATTAACAGCATTGAAAATCG
TGTTCACATCGGGCGTTGTGGTGCTATTACTCCACTGCTGTCACTTTTATACTCAGAAGAAAAGCTAACTCAAGAACACG
CAGTCACGGCTCTTTTGAATCTTTCCATCAGTGAACTAAACAAAGCCATGATTGTGGAAGTCGGGGCGATAGAACCGCTT
GTTCATGTTTTGAACACAGGAAATGACAGAGCCAAAGAGAATTCAGCAGCATCATTGTTCAGTCTGTCTGTTCTGCAGGT
CAACAGAGAACGAATAGGCCAGTCTAACGCAGCGATACAAGCTCTGGTGAATCTTCTTGGTAAAGGAACATTTAGAGGAA
AGAAAGACGCCGCCTCTGCTTTGTTCAATCTATCGATTACTCATGATAACAAGGCCCGTATCGTGCAAGCTAAGGCGGTT
AAGTACCTTGTGGAGCTGTTAGACCCAGATTTAGAGATGGTTGATAAAGCAGTTGCTCTTCTTGCAAATCTTTCTGCAGT
TGGAGAAGGGCGTCAAGCCATCGTGAGGGAAGGTGGGATTCCATTACTTGTTGAAACTGTTGACTTAGGATCTCAGAGAG
GGAAAGAGAATGCAGCTTCTGTGCTGCTTCAGTTGTGTCTGAACAGTCCCAAGTTTTGCACTCTGGTCTTGCAAGAAGGC
GCCATACCTCCGCTTGTTGCCTTGTCTCAGTCTGGTACACAGAGAGCAAAAGAGAAGGCACAGCAACTTCTTAGCCACTT
CCGAAACCAGAGAGATGCAAGGATGAAGAAAGGTAGATCATGA