Details for Arabidopsis Locus AT3G36659

Position : Chr3 ( 5`- 2100189 .. 2100983 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G36659

Protein [Map View]
MEFNKTYRIIVIFTVSILVTISTHVESRSDSPFSTPAPAPEVMKPIASPANSPAEIYTDSPVASPEAPADSFSPKNPPVE
IDIYSPAASPEAPVASPEAPAESSSAAPSGIKVSSSPKSLLNPPLLSPEIKTICGKTDNPPLCESSVSPLLTPQLKPNTS
SVLILAIQASITATKAAMAIVEKVDASDCQELYDDAVVNLEDAVNAVKSSDIATVNTNLSAAMTDYSTCNDGFEESGEPN
PLAYVADKLTKMVSNCLAISTLIK*

DNA
ATGGAGTTCAACAAAACCTATCGGATCATCGTGATCTTCACGGTTTCTATTTTGGTCACCATCTCTACGCATGTAGAATC
CAGATCAGATTCTCCATTTTCGACACCAGCTCCGGCACCGGAAGTTATGAAACCTATCGCTAGTCCTGCAAATTCTCCGG
CGGAGATATATACAGACTCTCCCGTTGCGTCTCCAGAAGCTCCAGCAGATTCATTTTCCCCAAAAAATCCTCCGGTCGAG
ATAGATATATACTCTCCCGCAGCGTCACCAGAGGCTCCTGTCGCATCACCAGAAGCTCCTGCGGAGTCTTCCTCTGCTGC
ACCATCTGGAATCAAAGTTTCGAGTTCTCCCAAAAGCCTTTTGAACCCGCCATTGTTATCTCCGGAGATCAAAACCATTT
GCGGCAAAACCGATAACCCTCCGTTATGCGAATCTTCCGTTAGTCCTCTCTTAACGCCTCAACTGAAACCAAACACTTCC
TCCGTCCTCATTCTCGCTATTCAAGCTTCGATCACCGCGACCAAGGCGGCCATGGCCATCGTCGAAAAAGTCGACGCCTC
CGATTGTCAGGAGTTATATGATGATGCAGTTGTGAATTTGGAAGATGCAGTTAACGCCGTCAAGTCAAGTGACATTGCCA
CCGTTAACACAAACTTGAGCGCAGCGATGACAGATTACAGCACGTGTAACGACGGTTTTGAAGAATCGGGAGAGCCTAAC
CCGTTGGCTTACGTGGCCGATAAGCTTACGAAGATGGTTAGTAACTGTCTCGCCATCTCTACGTTGATCAAGTGA