Details for Arabidopsis Locus AT3G29060

Position : Chr3 ( 5`- 11044990 .. 11048465 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G29060

Protein [Map View]
MKFGREFETQMIQEWKEAYMDYRSLKSIVKQILRYRLQKQQRPPPPPPPPSTGDTVPLKTDGGEGGGGGGGGGPGLSRRI
SLYRAFSGLTNRASRSPKKSHKHHNPLSSKRHHHHHNHHHYHLFDDDEEQIILINEDETASYTTTFLNSAEEGGEMEVQF
FRRLDGEFNKVLRFYKQKVENVMEEADELSRQLNVLIALRVKVENPHVHLPPDLNSVASAPSSPHSTMRTPAPSPMDVIR
EMEKTEDKKVFKPAPVEMLDHVKLKIDPETPLLTLKMMILGLPSEQTFSKPELRRAEELMNRAFVEFYQKLRFLKSYCFL
NQLAFAKILKKYDKTTSRNASKPYLNTVDHSYLGSCDEVSRLMSRVEATFIKHFANGNHREGMKCLRPKTKREKHRITYF
LGFFSGCAVALAIAITVLVHIRGLTKSEGRHQYMENIFPLYSLFGFVAVHLFMYAADIYFWSRYRVNYPFIFGFEQGNDL
GYREVLLVGSGLAVLTFGGVISNLDMEMDPRTKSFSVITELVPLALLVCLMMVLFCPFNIIYRSSRYFFVGSVFRCLLSP
LYKVILPDFFLADQLTSQVQTFRSLLFYVCYYGWGGDFKRRTHTCYDSEIYKELYLVVAIIPYWFRFAQSIRRLVEEKDK
MHGLNALKYLSTILAVAARTIFEMKRGTYWLTVAVTTSSIATLFNTYWDIFRDWGLMNRNSKNPWLRDKLLVPYKSIYFI
VMVANVVLRLAWMQTVLGIKEAPFLHKRALVAVVASLEIVRRGIWNFFRLENEHLNNVGKYRAFKSVPLPFQELGGSKSV
*

DNA
ATGAAGTTTGGAAGAGAATTTGAAACGCAGATGATCCAAGAATGGAAAGAAGCCTACATGGATTATCGTTCTCTTAAATC
AATAGTCAAACAGATCCTTCGTTATCGCCTACAAAAACAACAACGTCCTCCTCCTCCTCCTCCTCCTCCTTCAACCGGAG
ACACCGTACCTCTTAAAACAGACGGTGGAGAAGGCGGAGGAGGCGGAGGCGGAGGCGGACCAGGATTATCGAGAAGAATC
TCTCTTTACCGCGCATTTAGCGGTTTAACAAACCGAGCTTCTCGTTCTCCTAAGAAATCACATAAACATCATAATCCTTT
AAGCAGCAAACGCCATCATCATCATCATAATCATCATCATTATCATCTCTTTGACGACGACGAGGAACAAATCATTTTGA
TTAATGAAGACGAGACAGCGAGTTATACGACGACGTTTCTTAACTCAGCTGAGGAAGGAGGGGAGATGGAGGTTCAGTTT
TTCAGGCGACTCGACGGTGAATTCAACAAGGTTTTGAGATTTTATAAGCAAAAAGTTGAAAATGTTATGGAGGAAGCTGA
TGAGCTTAGTAGACAATTAAATGTTTTGATTGCTCTTAGAGTTAAAGTTGAGAATCCTCACGTTCATCTTCCTCCTGACC
TTAATAGCGTCGCGAGTGCTCCTTCTTCTCCTCATTCAACAATGAGGACTCCAGCCCCTTCACCAATGGATGTGATTAGA
GAAATGGAAAAGACCGAAGATAAGAAAGTATTTAAACCTGCTCCAGTAGAAATGTTGGATCATGTAAAGCTCAAAATCGA
TCCCGAAACTCCGTTGTTAACTCTCAAAATGATGATTCTTGGTCTCCCAAGTGAGCAAACCTTCAGCAAACCCGAGCTTA
GGAGAGCCGAAGAGCTTATGAACCGCGCTTTTGTTGAGTTTTATCAAAAACTTAGGTTCTTAAAGAGTTATTGCTTCTTG
AATCAATTGGCGTTTGCAAAGATACTAAAGAAGTATGACAAGACTACTTCGAGGAATGCATCAAAGCCTTATCTAAATAC
AGTAGATCACTCGTATTTGGGTAGCTGTGATGAGGTCTCAAGGCTCATGTCGAGAGTGGAAGCGACGTTTATTAAGCATT
TCGCTAATGGAAATCACCGAGAAGGAATGAAATGTTTAAGGCCTAAAACTAAGAGGGAGAAACACAGAATCACTTACTTT
CTTGGCTTCTTTTCCGGTTGCGCTGTCGCTCTCGCCATTGCGATAACGGTTCTTGTACATATTAGAGGCTTAACAAAAAG
TGAGGGCAGGCATCAGTACATGGAGAACATTTTTCCTCTTTACAGCTTGTTCGGGTTTGTTGCGGTTCATTTGTTTATGT
ATGCGGCAGACATATATTTTTGGAGTCGATACCGAGTAAATTACCCGTTTATCTTCGGGTTTGAGCAAGGAAATGATCTT
GGTTATAGAGAAGTTCTTCTGGTAGGCTCTGGTCTAGCAGTTTTAACATTTGGAGGAGTCATCTCAAATCTCGACATGGA
AATGGATCCAAGAACCAAAAGTTTCAGTGTCATCACCGAGCTCGTTCCTTTAGCTCTTCTAGTCTGCTTGATGATGGTAC
TGTTCTGTCCATTCAATATAATATATCGCTCGAGCCGATATTTCTTCGTTGGAAGCGTCTTTCGCTGTCTTTTAAGTCCT
CTCTACAAGGTTATTCTCCCGGACTTCTTCCTCGCAGATCAATTGACAAGTCAGGTCCAAACATTCAGAAGCTTATTGTT
TTATGTTTGCTACTATGGTTGGGGAGGAGATTTTAAGAGACGAACACACACATGTTATGATAGTGAGATTTACAAAGAAC
TCTACCTTGTTGTTGCCATCATTCCTTACTGGTTCCGCTTCGCTCAGTCTATTAGGAGGTTGGTCGAGGAGAAAGACAAA
ATGCATGGCCTTAACGCACTAAAGTATCTATCGACTATATTGGCGGTTGCGGCTAGGACAATTTTTGAGATGAAGAGAGG
GACGTACTGGCTCACGGTGGCAGTAACCACTTCGAGCATTGCCACGTTGTTCAATACTTATTGGGACATTTTCAGGGACT
GGGGTCTGATGAACCGCAACTCCAAGAACCCGTGGCTTCGTGACAAACTCTTAGTACCTTACAAAAGCATCTACTTCATT
GTCATGGTGGCGAATGTGGTGCTGAGGCTGGCATGGATGCAGACTGTTCTTGGGATTAAAGAAGCTCCATTTTTACACAA
AAGAGCTTTGGTTGCTGTTGTTGCAAGTTTAGAGATTGTTCGTCGTGGCATTTGGAACTTTTTCAGGTTGGAGAATGAGC
ATTTGAACAACGTGGGGAAATACAGAGCCTTCAAGTCTGTACCTTTGCCTTTTCAAGAACTTGGAGGAAGTAAGAGCGTG
TAA