Details for Arabidopsis Locus AT3G29030

Position : Chr3 ( 5`- 11011308 .. 11013358 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G29030

Protein [Map View]
MGVLVISLLVVHLLAFSVCVQGGYRRGGHHPGGHMGPWINAHATFYGGGDASGTMGGACGYGNLYSQGYGLETAALSTAL
FDQGLSCGACFELMCVNDPQWCIKGRSIVVTATNFCPPGGACDPPNHHFDLSQPIYEKIALYKSGIIPVMYRRVRCKRSG
GIRFTINGHSYFNLVLVTNVGGAGDVHSVSMKGSRTKWQLMSRNWGQNWQSNSYLNGQSLSFVVTTSDRRSVVSFNVAPP
TWSFGQTYTGGQFRY*

DNA
ATGGGAGTTTTAGTAATCTCGCTTCTCGTGGTTCATCTCCTAGCTTTTTCCGTCTGCGTTCAGGGCGGCTACCGTCGTGG
CGGACACCATCCCGGCGGTCACATGGGACCTTGGATCAACGCTCATGCCACTTTTTACGGCGGCGGTGATGCTTCCGGCA
CTATGGGTGGAGCATGCGGGTACGGCAATCTGTATAGCCAAGGTTATGGACTGGAGACGGCAGCGCTGAGCACAGCGTTA
TTCGACCAAGGACTTAGTTGTGGCGCATGTTTTGAGCTGATGTGTGTCAACGATCCTCAATGGTGCATAAAAGGCCGATC
CATTGTGGTCACTGCCACTAACTTTTGTCCTCCTGGTGGTGCATGCGACCCTCCCAACCACCATTTCGATCTTTCTCAGC
CGATCTACGAGAAAATTGCTCTCTACAAATCCGGTATCATTCCCGTTATGTATAGAAGGGTTCGGTGCAAGAGAAGTGGT
GGGATAAGGTTCACGATCAACGGCCACTCATACTTTAACTTGGTGTTGGTCACAAACGTGGGTGGAGCCGGGGACGTACA
CTCGGTCTCAATGAAAGGGTCGAGGACAAAATGGCAATTAATGTCGAGAAATTGGGGGCAAAATTGGCAAAGCAACTCTT
ATCTCAATGGTCAAAGTCTGTCGTTTGTTGTTACCACAAGTGATCGTCGAAGTGTCGTCTCTTTTAATGTTGCACCACCC
ACTTGGTCCTTTGGCCAGACCTACACCGGAGGGCAGTTTCGGTATTAA