Details for Arabidopsis Locus AT3G25530

Position : Chr3 ( 5`- 9271800 .. 9273615 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G25530

Protein [Map View]
MEVGFLGLGIMGKAMSMNLLKNGFKVTVWNRTLSKCDELVEHGASVCESPAEVIKKCKYTIAMLSDPCAALSVVFDKGGV
LEQICEGKGYIDMSTVDAETSLKINEAITGKGGRFVEGPVSGSKKPAEDGQLIILAAGDKALFEESIPAFDVLGKRSFYL
GQVGNGAKMKLIVNMIMGSMMNAFSEGLVLADKSGLSSDTLLDILDLGAMTNPMFKGKGPSMNKSSYPPAFPLKHQQKDM
RLALALGDENAVSMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSRE*

DNA
ATGGAAGTAGGGTTTCTGGGTTTGGGAATCATGGGAAAAGCCATGTCAATGAATCTATTGAAGAATGGATTCAAAGTCAC
TGTATGGAACAGAACACTCTCCAAGTGTGATGAGCTTGTGGAGCATGGTGCATCAGTATGTGAGAGTCCAGCTGAAGTAA
TCAAGAAATGCAAATACACTATTGCTATGCTCTCTGATCCTTGTGCTGCTCTTTCGGTTGTTTTCGATAAAGGCGGTGTT
TTGGAGCAGATATGTGAAGGAAAAGGTTATATCGATATGTCGACTGTTGATGCAGAGACTTCTTTGAAGATCAATGAGGC
AATCACCGGGAAGGGTGGTCGGTTCGTAGAAGGTCCGGTTTCAGGTAGCAAAAAGCCAGCTGAAGATGGCCAACTCATTA
TCCTTGCTGCTGGTGACAAGGCACTCTTTGAGGAATCAATCCCAGCTTTTGATGTCTTGGGGAAGAGATCGTTTTACTTG
GGACAAGTTGGAAACGGAGCTAAAATGAAGCTAATAGTGAACATGATAATGGGAAGCATGATGAATGCATTCTCTGAGGG
GCTTGTATTGGCTGACAAGAGTGGACTTAGCTCTGACACTCTTTTGGATATTCTGGATCTGGGAGCAATGACTAACCCGA
TGTTCAAGGGGAAAGGACCTTCAATGAACAAGAGTAGTTACCCACCAGCATTTCCATTGAAACATCAGCAGAAAGACATG
AGGCTAGCTCTTGCTCTTGGCGATGAAAACGCGGTTTCCATGCCTGTAGCCGCGGCTGCAAACGAGGCTTTTAAGAAGGC
GAGAAGCTTGGGACTAGGAGATCTCGACTTCTCTGCTGTGATTGAAGCTGTGAAATTCTCCCGCGAATAG