Details for Arabidopsis Locus AT3G25480

Position : Chr3 ( 5`- 9235196 .. 9236607 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G25480

Protein [Map View]
MTSLPIILASSPLRNLTKPCSTSQIPKPIQNSTKQPPIHLLTKTNLSVTISQLIITSPVLASESFDSISSDPSSGKIDLE
SILVTIDNFFNKYPFFVAGCTFTYLVVYPAVMFYLRKYKPISAMNAFRKLKNESDSQLLDIRDVKTLALLASPNLKFLGK
SSVQVPFSENDEEGFLTKVKGSFSDAENTVVCVLDNFDGNSSKVAELLIKNGFKEAYYIRGGARGKNGWLAIQEELLPPP
VHMYTAKNVKSSNNNEASVVGTEN*

DNA
ATGACGTCTCTTCCAATAATCCTCGCATCCTCTCCACTGCGAAACCTAACCAAACCTTGTTCAACTTCTCAAATCCCAAA
ACCCATTCAAAATTCTACAAAACAACCTCCAATACATCTCCTAACCAAAACCAATCTCTCTGTAACCATTTCCCAACTAA
TTATCACTTCCCCTGTTCTCGCATCTGAATCATTCGACTCAATTTCATCAGACCCATCTTCTGGAAAAATCGATTTAGAG
TCAATTTTGGTCACAATTGATAATTTCTTCAACAAGTATCCATTTTTCGTAGCGGGATGTACTTTTACCTATCTTGTTGT
TTATCCAGCTGTGATGTTTTACTTGAGGAAGTATAAACCAATATCCGCCATGAACGCGTTTCGTAAGCTTAAGAATGAAT
CTGATTCTCAGCTTTTGGATATTAGAGATGTCAAGACTTTGGCTTTGTTAGCATCACCGAATCTTAAGTTTTTGGGTAAG
AGTTCTGTTCAGGTTCCGTTTAGTGAGAATGATGAAGAAGGGTTTTTGACGAAAGTTAAAGGAAGCTTCTCTGATGCTGA
GAATACAGTTGTTTGTGTTCTTGATAATTTTGATGGTAACTCGTCGAAAGTAGCTGAATTGCTGATCAAGAATGGTTTCA
AAGAGGCTTATTATATTAGAGGCGGCGCGAGAGGGAAGAATGGTTGGTTGGCTATTCAAGAAGAGCTTTTGCCTCCACCG
GTGCATATGTACACTGCGAAAAACGTAAAATCTTCAAACAACAATGAAGCGTCTGTTGTTGGAACTGAGAACTAG