Details for Arabidopsis Locus AT3G25470

Position : Chr3 ( 5`- 9232919 .. 9235213 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G25470

Protein [Map View]
MGFHVLRPPIALRSSLLGFLSKSHNPLLPGRWVQAGECSTMRCFASATRGKNKKQRLDEACVERFNEYSRTLIQSWIMQG
KVLVDGRRVIKAGMPVSTTAAIKITAEVPKFVCRGGLKLEAALEKLDVDVSEKVVLDAGLSTGGFTDCLLRYGAAHVYGV
DVGYGQVADKIRNDKKVTVIERTNLRYLPGLPQKVDVVTLDLSFISILKVMPAIMNVMKEDATLVTLVKPQFEARRQQVG
KGGIVRDPEVHQEVLEKIINGVERYGFTNKGFIESPIKGADGNIEFLACFNRGTVKPEAEE*

DNA
ATGGGATTTCATGTTCTTAGACCTCCCATAGCTTTACGCAGCTCTCTCCTCGGCTTCTTATCCAAATCACACAATCCTCT
TCTCCCCGGGAGATGGGTTCAAGCTGGAGAATGCAGTACCATGAGATGTTTTGCTTCTGCTACTCGTGGCAAAAACAAAA
AACAGAGACTAGATGAGGCATGTGTTGAAAGGTTTAACGAATACAGTCGCACACTAATACAATCGTGGATTATGCAAGGC
AAAGTTCTTGTGGATGGGAGAAGAGTTATTAAAGCTGGAATGCCTGTATCTACTACTGCAGCTATAAAGATCACAGCTGA
GGTTCCAAAATTTGTATGTAGAGGTGGACTCAAGCTGGAAGCTGCACTTGAGAAGCTAGATGTTGATGTTTCTGAGAAAG
TAGTTCTTGATGCAGGACTTTCTACTGGAGGGTTTACGGATTGTTTGCTACGTTATGGTGCTGCTCATGTTTATGGCGTA
GATGTTGGTTACGGTCAGGTAGCTGACAAAATTCGCAATGATAAGAAAGTGACTGTTATAGAAAGGACAAATCTGAGATA
CCTCCCAGGACTCCCACAAAAAGTCGATGTAGTGACGCTTGACCTCTCTTTCATTTCCATTCTTAAGGTGATGCCAGCTA
TTATGAATGTGATGAAAGAAGATGCGACTTTAGTTACCCTTGTTAAACCCCAATTTGAAGCTCGAAGACAACAGGTCGGG
AAGGGTGGCATAGTGAGAGATCCCGAAGTACATCAAGAGGTTCTTGAGAAGATAATAAACGGTGTTGAGCGCTATGGATT
TACCAACAAAGGCTTTATCGAATCTCCCATAAAGGGCGCAGACGGAAACATAGAGTTCTTGGCTTGCTTTAATCGAGGGA
CAGTAAAACCTGAAGCCGAAGAATAG