Details for Arabidopsis Locus AT3G25460

Position : Chr3 ( 5`- 9231581 .. 9232666 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G25460

Protein [Map View]
MMMPELPEDLLVEILCRVPATSLKRLRSTCKLWNHLYNDKRFKSKHCHKAPRQSLILMWKNFGFSSISINLQRVSPIEVT
GELNLIDHHSSLGMFRNSPLCQTSGLLLCVNVEKINTRLVVWNPCTGKTKWIQHRRMGYICNYALGSYQDKKSDNNSYKI
LSHGIYGGQEFEIYEINSNSWRILDVTVDSSLYIENVSLKGKTYWFATDGNDKPCDLFLICFDYTTERFERLCLPYQIPY
FRNTSLSVVKEEKLSVLLQPSLTSKTQIWVTNKIGEAKVLSWIKFLTVDLKPEIKYGIKFLVDEENKVLVYEQNFVINGK
NNMIYVVGEDNEVREVVFRVGLKPLFFYYVPSLTQIRQGND*

DNA
ATGATGATGCCAGAACTTCCAGAGGATTTGTTAGTGGAGATACTCTGCCGCGTTCCGGCTACATCTTTGAAACGATTACG
ATCTACTTGCAAACTATGGAACCATTTATACAACGATAAGAGATTCAAAAGCAAACACTGCCATAAAGCCCCAAGGCAAT
CTCTGATTCTCATGTGGAAGAATTTTGGTTTTTCTTCGATTAGCATCAATCTCCAAAGAGTTTCACCTATAGAGGTCACT
GGTGAACTTAACCTAATCGACCATCATTCTAGTTTAGGTATGTTCAGGAACTCTCCATTATGTCAAACTTCTGGCTTATT
GTTATGCGTCAACGTGGAGAAAATTAATACTAGGCTCGTGGTATGGAACCCGTGTACTGGTAAAACCAAGTGGATTCAAC
ACAGAAGGATGGGCTACATCTGCAACTATGCTCTTGGATCCTACCAAGACAAAAAATCCGACAATAATAGCTACAAAATA
TTGAGCCACGGGATTTATGGTGGCCAAGAGTTCGAAATTTATGAGATTAACTCAAATTCATGGAGGATTCTTGATGTCAC
TGTGGACTCCTCTTTGTACATTGAAAACGTTTCTTTGAAGGGTAAGACTTACTGGTTTGCTACAGATGGAAATGATAAAC
CGTGCGACCTATTCTTGATCTGTTTTGATTATACGACAGAAAGATTTGAACGTCTATGTCTTCCGTATCAGATTCCGTAT
TTTCGTAATACATCTCTATCAGTTGTTAAAGAAGAGAAACTTTCCGTGTTATTACAACCTTCCCTTACATCGAAGACACA
GATATGGGTGACAAATAAGATTGGTGAGGCCAAAGTGTTGTCGTGGATCAAGTTTTTAACGGTGGATTTGAAGCCTGAGA
TTAAATATGGCATAAAATTCTTGGTCGATGAGGAGAACAAAGTCCTTGTGTATGAGCAAAATTTTGTAATAAACGGCAAA
AACAACATGATATACGTCGTTGGAGAGGACAACGAAGTTAGGGAAGTGGTGTTTAGAGTCGGATTAAAACCATTATTCTT
TTATTATGTTCCAAGTTTGACTCAAATCCGGCAAGGTAATGATTAA