Details for Arabidopsis Locus AT3G25440

Position : Chr3 ( 5`- 9223967 .. 9225710 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G25440

Protein [Map View]
MGFLTAAIRVSTSAASMLLRRKSRQLGFLASSSPLFSSFNSMNRTISSCNIVCKVLHKESLTRPMWNVSFLRSSSFHSTP
ARETGDDDISKSENSSSQDGDSCTKLKRKKLKGKRAVVRWLKFFRWKKKKEFERMTSEEKILNKLRKARKKEERLMETMK
KLEPSESAETTHDPEILTPEEHFYYLKMGLKCKNYVPVGRRGIYQGVILNMHLHWKKHQTLQVVIKTFTPDEVKEIAVEL
ARLTGGIVLDVHEGNTIIMYRGKNYVQPPTEIMSPRITLPRKKALDKSKCRDALRAVRKYIPRLEQELQLLQAQAETKRD
YTNVKVDDNQERSEELKKIIERSEECLEDEQEEDEAGLELATDSDLSDIFETDSELEDAKTERPLFLEEFEKFPAINNRE
DEDFGDLGKAKSEGEENDDDKSPNFDEVDKMFLRAAFLLKKKRR*

DNA
ATGGGGTTTCTGACGGCGGCGATTAGGGTTTCGACATCAGCAGCCTCAATGCTTCTACGCCGTAAATCTCGGCAGCTAGG
GTTCCTAGCCTCCTCCTCGCCGCTTTTTTCCAGCTTTAATTCCATGAATCGCACTATCAGCTCGTGTAATATTGTGTGCA
AGGTTTTGCATAAGGAATCTCTTACTAGACCAATGTGGAACGTTAGCTTCTTAAGATCCTCTTCGTTTCATTCAACTCCA
GCTCGTGAGACCGGTGATGATGACATTAGCAAATCTGAGAACAGTTCGAGTCAAGATGGAGACAGTTGTACTAAATTAAA
GAGGAAGAAGCTGAAAGGTAAGCGTGCGGTTGTGCGGTGGCTAAAGTTTTTCCGGTGGAAGAAAAAGAAAGAATTTGAAA
GAATGACTTCTGAAGAAAAGATACTTAACAAACTAAGAAAGGCTCGAAAGAAAGAGGAACGGCTTATGGAGACGATGAAG
AAGCTGGAACCTTCAGAGTCAGCAGAAACGACACATGACCCTGAGATATTGACTCCAGAAGAACATTTTTATTATCTGAA
AATGGGTTTGAAGTGCAAGAATTATGTTCCTGTAGGGAGACGTGGGATTTACCAAGGAGTGATTCTGAACATGCATCTTC
ACTGGAAGAAGCATCAGACGCTACAGGTTGTGATCAAAACGTTTACACCTGATGAAGTGAAGGAGATTGCTGTTGAGTTA
GCGAGGTTGACTGGAGGGATTGTGCTTGATGTACATGAAGGTAACACGATAATTATGTACAGAGGGAAGAACTATGTGCA
ACCTCCTACTGAAATCATGTCGCCGAGGATTACTCTTCCGAGGAAAAAGGCTTTGGATAAGTCTAAATGTAGGGATGCGC
TTCGTGCGGTTAGGAAGTATATTCCGAGGCTTGAACAGGAGCTCCAGTTGCTTCAAGCACAAGCTGAAACGAAGCGGGAT
TACACGAATGTGAAGGTTGATGATAATCAAGAGAGGTCAGAAGAGTTGAAGAAGATTATAGAAAGAAGCGAAGAGTGTTT
GGAGGATGAGCAAGAAGAAGATGAAGCAGGATTAGAACTAGCGACGGATTCAGATCTTTCGGATATTTTTGAGACTGATT
CGGAATTAGAAGATGCGAAAACAGAGCGACCACTTTTTCTTGAGGAGTTTGAGAAATTCCCAGCTATAAACAACAGAGAA
GACGAAGACTTTGGGGATCTCGGGAAGGCTAAATCAGAAGGTGAGGAGAATGATGATGATAAGTCACCAAACTTTGATGA
AGTAGATAAGATGTTTCTTCGGGCTGCTTTTCTTTTAAAGAAGAAAAGACGATGA