Details for Arabidopsis Locus AT3G25420

Position : Chr3 ( 5`- 9217832 .. 9220925 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G25420

Protein [Map View]
MGRLVEAIIASILLSLCFTITKSAPKSALITNLPGFNGTFPSKHYAGYVAIDKHRNKNLWYYFVESERNASVDPVVLWLN
GGPGCSSMDGFVYEHGPFNFEPKKKNSHLLHLNPYSWSKVSNIIYLDSPVGVGFSYSNDNADYTTDDTKTASDTHTFLLE
WFKMFPEFQSNPFFISGESYAGIYVPTLAAEVVKGHKNVTKPVINFKGYLVGNGVTDEVFDGNALVPFTHGMGLISDELY
EETKLVCNGTYYTGGQSGVSKECAGKLKTVSDTVNLLNLYNILEPCYHGTSLSALDIEFLPKSLLTLGKTEKPMAVRKRM
FGRAWPLGAVVRPGIVPSWSQLLAGFGVPCIDDTVATKWLNDPAVRKAVHAKEVSIQFIIFLSISISIGNWELCSSNLEY
RHDTGSMIEYHRNLTLSGFRALIFSGDHDMCVPYTGSEAWTKAMGYKVVDEWRPWMSNNQVAGFTQGYANNLTFLTIKGA
GHTVPEYKPRESLDFYSRFLAGEKI*

DNA
ATGGGTCGGTTAGTAGAAGCTATCATTGCTTCGATATTATTGTCTTTGTGTTTTACAATAACAAAGTCAGCTCCAAAATC
TGCTCTCATTACCAATCTTCCTGGTTTCAACGGCACTTTTCCATCTAAACACTATGCCGGGTATGTGGCAATAGATAAAC
ATCGTAATAAGAATCTATGGTATTACTTTGTGGAATCTGAGAGAAATGCTTCGGTAGATCCAGTTGTGCTTTGGCTTAAT
GGTGGTCCAGGTTGCTCTAGCATGGATGGATTTGTCTACGAGCACGGTCCATTCAATTTCGAACCAAAAAAGAAGAACTC
ACATCTTTTGCATCTCAATCCTTATAGTTGGTCCAAGGTGTCCAACATCATATACCTTGACTCTCCAGTTGGTGTGGGAT
TCTCTTACTCAAATGACAACGCCGATTATACAACTGATGATACAAAAACCGCGTCTGATACTCACACATTCCTTCTCGAG
TGGTTTAAAATGTTTCCGGAGTTTCAGTCAAATCCGTTCTTTATATCAGGAGAATCATATGCTGGTATCTATGTGCCAAC
TCTTGCGGCCGAGGTTGTCAAAGGTCACAAGAATGTGACAAAGCCGGTTATCAACTTCAAGGGATATTTGGTGGGTAATG
GTGTTACCGATGAGGTGTTTGATGGTAATGCTCTTGTTCCCTTCACTCATGGCATGGGACTCATCTCTGATGAACTCTAT
GAGGAAACTAAATTAGTGTGCAACGGAACATACTATACCGGCGGCCAGTCAGGAGTGAGTAAAGAATGTGCTGGCAAACT
TAAAACAGTGTCAGATACTGTGAACTTATTGAACTTATATAACATTCTAGAACCGTGCTACCACGGAACATCTCTATCCG
CCTTAGATATCGAGTTTCTGCCTAAGAGTCTCCTTACTCTAGGCAAAACAGAAAAGCCAATGGCGGTGAGAAAGAGAATG
TTTGGTCGTGCATGGCCTCTAGGTGCCGTTGTGCGTCCAGGCATTGTACCTAGTTGGTCTCAACTCCTCGCTGGCTTTGG
TGTTCCTTGCATTGACGATACAGTTGCGACCAAATGGCTAAACGATCCAGCTGTAAGGAAAGCGGTTCATGCTAAAGAGG
TCTCTATTCAATTCATCATATTTCTCTCAATCAGTATTTCGATTGGAAATTGGGAGTTATGTTCAAGCAACCTCGAATAT
AGGCACGACACCGGTAGCATGATCGAATACCATAGAAACCTCACTCTTAGTGGCTTTCGAGCTCTCATTTTCAGTGGAGA
TCATGATATGTGTGTACCATATACTGGCTCTGAAGCATGGACTAAGGCAATGGGATACAAAGTGGTTGATGAATGGAGGC
CATGGATGTCAAATAACCAAGTCGCCGGGTTTACACAAGGGTATGCCAATAATCTCACATTTCTAACCATCAAGGGTGCA
GGACATACCGTTCCAGAATACAAACCGCGTGAATCTTTGGACTTCTATAGTCGTTTCCTAGCAGGAGAAAAGATATAG