Details for Arabidopsis Locus AT3G25410

Position : Chr3 ( 5`- 9214339 .. 9216490 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G25410

Protein [Map View]
MTLIASLSLPPPAIQRQSLSEFHNLPAKSQSFNCQFRSSSSPLSSLHSSSLSNFLDFRLRRRNSGLVPVVACSTTPFMGR
VGLHWRDGNMSLLSFCGGTDVTEKADSSQFWSALLPFVVALTAVAALSYPPSFTWVSKDLYAPALGGIMLSIGIQLSVDD
FALAFKRPVPLSVGFVAQYVLKPLLGVLVANAFGMPRTFYAGFILTCCVAGAQLSSYASSLSKADVAMSILLTSSTTIAS
VIFTPLLSGLLIGSVVPVDAVAMSKSILQVVLVPITLGLVLNTYAKPVVTLLQPVMPFVAMVCTSLCIGSPLSINRSQIL
SAEGLGLIVPIVTFHAVAFALGYWFSKIPGLRQEEEVSRTISLCTGMQSSTLAGLLASQFLGSSQAVPAACSVVVMAIMG
LCLASFWGNGFRIRDVLSLSTPQSTGYTAES*

DNA
ATGACTTTAATCGCTTCTCTGTCTCTCCCACCACCAGCTATACAAAGACAATCACTTTCTGAATTTCATAATCTTCCCGC
TAAATCTCAATCCTTCAATTGTCAATTCCGGTCTTCTAGTTCACCTTTATCTTCTCTCCATTCTTCATCGCTTAGTAACT
TTCTAGATTTTAGACTAAGGCGGAGAAACAGCGGATTGGTTCCAGTGGTGGCGTGTTCAACGACGCCGTTTATGGGCAGA
GTTGGATTACATTGGAGAGATGGGAATATGTCTCTGTTATCGTTTTGTGGTGGAACTGATGTTACAGAGAAAGCTGATTC
GTCTCAGTTTTGGTCTGCTTTGCTTCCATTTGTTGTTGCTCTCACTGCCGTTGCTGCTCTCTCTTACCCACCTAGTTTCA
CTTGGGTATCTAAAGACCTCTATGCTCCTGCTCTTGGAGGGATTATGTTATCTATTGGAATTCAGCTTTCAGTTGACGAT
TTTGCTCTTGCATTCAAAAGACCAGTGCCGTTATCTGTTGGGTTTGTTGCTCAGTACGTTTTGAAACCGCTTCTCGGGGT
TTTAGTTGCTAATGCATTTGGGATGCCGAGGACCTTCTACGCTGGTTTTATACTCACGTGTTGTGTGGCTGGGGCTCAGT
TGTCTAGTTACGCGAGTTCTCTGAGTAAAGCTGATGTGGCCATGAGCATTCTTCTCACTAGTTCTACAACTATTGCTTCT
GTAATCTTTACACCTTTGCTTAGTGGTCTTCTAATTGGATCAGTAGTTCCTGTTGATGCAGTTGCCATGTCGAAGTCTAT
ACTTCAGGTGGTACTTGTTCCAATCACTCTTGGCCTTGTGTTAAATACTTATGCGAAGCCTGTGGTCACTCTTCTTCAAC
CTGTGATGCCGTTTGTTGCTATGGTATGCACTTCGTTGTGCATTGGAAGCCCACTTTCGATTAATCGCAGTCAGATTCTG
TCAGCTGAAGGTCTTGGATTGATTGTTCCAATTGTTACATTCCATGCCGTAGCATTTGCCTTAGGATATTGGTTCTCTAA
GATCCCAGGCTTACGACAAGAGGAAGAAGTAAGCCGGACTATCTCCCTTTGCACGGGAATGCAAAGCTCCACATTAGCCG
GGCTTCTTGCAAGCCAGTTCCTTGGTAGCAGCCAAGCCGTGCCAGCAGCTTGCTCTGTAGTTGTAATGGCCATAATGGGT
CTATGCCTTGCCTCTTTCTGGGGCAATGGGTTTCGAATCAGGGACGTTCTATCGCTATCAACACCGCAAAGCACTGGCTA
CACCGCTGAATCATGA