Details for Arabidopsis Locus AT3G25250

Position : Chr3 ( 5`- 9195503 .. 9197124 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G25250

Protein [Map View]
MLEGDEKQSRALDFNRLEVLSLLGRGAKGVVFLVRDDDAKLLALKVILKEAIEKKKKGRESEDDEYKRVSFEQGVLSRFD
HPLFPSLHGVLATDKVIGYAIDYCPGQNLNSLRKMQSESMFSDEIIRFYAAELVLALDYLHNQGIVYRDLKPDNVMIQEN
GHLMLIDFDLSTNLAPRTPQPSPSLSKPSPTMKRKKRLFRFTSFCNSGISPQESISVHSSSTLAVSDSSGEKSNSFVGTE
EYVAPEVISGDGHDFAVDWWSLGVVLYEMLYGATPFRGSNRKETFYRILSKPPNLTGETTSLRDLIRRLLEKDPSRRINV
EEIKGHDFFRGVDWEKVILVSRPPYIPAPDDGGDKGTDVNTKMDVENIVQEIFAARQEREKQSGDNNKNANMKIKDNTSG
EWVKGLNNNHDLESDNNFLVF*

DNA
ATGCTAGAGGGAGATGAGAAACAGAGCCGAGCTCTGGATTTCAATCGACTCGAGGTTTTGTCATTACTAGGTCGTGGAGC
TAAAGGAGTTGTGTTTCTTGTCCGCGACGACGACGCTAAATTGCTTGCTTTAAAAGTTATACTTAAGGAAGCCATCGAGA
AGAAAAAGAAGGGTAGAGAAAGTGAAGATGATGAGTATAAACGCGTGAGTTTCGAGCAAGGAGTATTAAGCAGATTCGAC
CATCCTCTCTTTCCGTCTCTTCACGGTGTTTTAGCTACCGATAAAGTCATCGGTTATGCGATCGATTATTGTCCGGGACA
GAATCTCAATTCTTTGAGGAAAATGCAATCGGAAAGTATGTTTTCCGACGAGATTATCAGATTTTACGCGGCGGAGCTTG
TATTAGCACTTGACTATTTACATAATCAAGGAATTGTGTATAGAGATTTGAAGCCAGACAATGTGATGATCCAAGAAAAT
GGACATTTAATGCTTATAGATTTCGATCTTTCTACAAATCTAGCTCCAAGAACGCCGCAACCGTCACCGTCACTGTCTAA
ACCATCGCCGACGATGAAGAGAAAGAAACGTCTCTTCCGCTTCACCAGTTTCTGCAACTCAGGAATCTCGCCGCAAGAAT
CTATCTCGGTTCACTCATCATCTACATTGGCCGTGTCAGATTCTTCAGGTGAGAAGTCAAATTCTTTCGTCGGAACAGAG
GAATACGTTGCGCCGGAGGTTATAAGCGGGGACGGTCACGATTTTGCCGTCGATTGGTGGTCGTTAGGGGTTGTTTTATA
TGAGATGTTGTATGGAGCGACGCCGTTTAGAGGATCGAACCGGAAAGAGACATTTTACCGGATTTTATCTAAACCGCCGA
ATCTAACTGGTGAAACGACGTCGTTGCGTGATTTGATTAGAAGATTGTTGGAGAAAGATCCTAGCCGTAGGATCAACGTT
GAGGAAATCAAGGGTCATGATTTCTTCAGAGGAGTAGATTGGGAAAAGGTGATTTTGGTTTCTAGACCGCCGTATATCCC
GGCGCCGGACGACGGTGGTGATAAGGGAACCGATGTAAATACGAAGATGGATGTGGAGAATATCGTCCAAGAGATTTTTG
CTGCAAGACAAGAACGTGAGAAACAGAGTGGTGATAACAATAAAAACGCTAATATGAAAATTAAAGATAATACTAGTGGG
GAATGGGTTAAGGGGTTGAATAATAATCACGATTTAGAAAGTGATAACAATTTTTTGGTATTTTAA