Details for Arabidopsis Locus AT3G25240

Position : Chr3 ( 5`- 9192540 .. 9193385 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G25240

Protein [Map View]
MAIFSRTKRVTDPLDDDAKARILSSHSYILDQDSPRLCELVHGFLEDGPEESFYDSDPDLSETSSAEHSGEASVEIVRMA
VSFSDSDPYRNLLLAHVLRAVEVYSGFRSRNKTVFRDKVASFLRELGHDAAVCVSKWTSSSKLIAGSYHFIDVVHKPSDN
DQKAVRYLVDLDFASEFEIARPTREYTRGLQLLPNVFVGNEENLRTIVRESCDAAKRSMKSRGLSLPPWRRSSYLQHKWF
GPYKRKVGSSLGVKPLNSDAVSCRSLGFDDGAVNTRLFIRA*

DNA
ATGGCGATTTTCTCCAGAACCAAACGTGTCACTGATCCACTTGACGACGACGCGAAGGCTCGGATCTTGAGCAGCCACAG
TTACATCCTAGACCAAGATTCTCCTCGACTCTGCGAGCTCGTACACGGGTTTCTTGAGGATGGTCCTGAAGAGTCATTCT
ACGACTCTGACCCCGACCTGTCTGAGACTTCTTCAGCTGAACATTCTGGTGAAGCTAGTGTGGAGATCGTGAGAATGGCG
GTGAGCTTCTCCGATTCCGATCCTTACCGGAATCTATTGCTAGCTCACGTTTTGAGAGCCGTGGAGGTATATTCCGGTTT
TAGGTCAAGGAACAAAACTGTTTTCCGGGATAAGGTAGCTTCGTTTCTGCGAGAGCTTGGTCACGACGCCGCGGTTTGTG
TATCAAAATGGACCTCTTCATCCAAACTCATCGCTGGGAGTTACCATTTCATTGACGTCGTTCACAAGCCGTCAGATAAT
GATCAGAAGGCCGTCCGTTACTTGGTTGATCTAGACTTTGCTTCGGAGTTCGAGATCGCAAGGCCAACGCGCGAATACAC
GCGTGGGCTGCAGCTGCTGCCTAACGTTTTCGTAGGAAATGAAGAGAATCTAAGGACGATCGTGAGAGAGTCATGCGACG
CGGCGAAGCGATCAATGAAGAGCCGTGGCTTGTCTCTTCCACCGTGGCGGAGAAGCTCTTACTTACAGCATAAGTGGTTT
GGTCCGTACAAAAGAAAGGTGGGATCTAGTTTGGGAGTGAAGCCGTTGAATAGTGACGCCGTTAGTTGCCGATCTTTAGG
GTTTGATGACGGCGCCGTCAATACTCGTTTGTTCATCAGGGCATGA