Details for Arabidopsis Locus AT3G25220

Position : Chr3 ( 5`- 9182616 .. 9184679 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G25220

Protein [Map View]
MMSSASAMKAVGFLLLLTILTLAYAKKSGDVTELQIGVKYKPQKCDLQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIE
FELGTGQVIPGWDQGLLGACVGEKRKLKIPSKLGYGDNGSPPKIPGGATLIFDTELVAVNGEPSSEAKSKNEL*

DNA
ATGATGAGCTCTGCATCCGCCATGAAAGCTGTTGGATTTTTGCTTCTGCTTACCATTCTAACATTAGCTTATGCGAAGAA
GTCAGGTGATGTGACAGAGTTGCAGATTGGTGTTAAGTACAAGCCTCAGAAATGTGATCTCCAGGCTCACAAAGGGGATA
AGATCAAGGTTCACTATCGGGGAAAGTTAACTGATGGAACTGTCTTTGATTCAAGTTTTGAGAGAGGTGACCCTATTGAG
TTTGAGCTTGGAACTGGTCAAGTCATCCCAGGATGGGACCAGGGTTTATTGGGAGCTTGTGTAGGTGAGAAGAGAAAGTT
GAAAATCCCATCCAAGCTTGGTTATGGTGATAACGGCTCACCACCAAAAATCCCGGGTGGGGCGACACTGATATTCGACA
CCGAGCTTGTTGCTGTGAACGGAGAACCATCCAGCGAAGCGAAATCAAAGAATGAGCTTTGA