Details for Arabidopsis Locus AT3G25180

Position : Chr3 ( 5`- 9167284 .. 9169282 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G25180

Protein [Map View]
MTFLFSTLQLSLFSLALVIFGYIFLRKQLSRCEVDSSTIPEPLGALPLFGHLHLLRGKKLLCKKLAAMSQKHGPIFSLKL
GFYRLVVASDPKTVKDCFTTNDLATATRPNIAFGRYVGYNNASLTLAPYGDYWRELRKIVTVHLFSNHSIEMLGHIRSSE
VNTLIKHLYKGNGGTSIVKIDMLFEFLTFNIILRKMVGKRIGFGEVNSDEWRYKEALKHCEYLAVIPMIGDVIPWLGWLD
FAKNSQMKRLFKELDSVNTKWLHEHLKKRSRNEKDQERTIMDLLLDILPEDIVISGHVRDVIVKATILALTLTGSDSTSI
TLTWAVSLLLNNPAALEAAQEEIDNSVGKGRWIEESDIQNLKYLQAIVKETHRLYPPAPLTGIREAREDCFVGGYRVEKG
TRLLVNIWKLHRDPKIWPDPKTFKPERFMEDKSQCEKSNFEYIPFGSGRRSCPGVNLGLRVVHFVLARLLQGFELHKVSD
EPLDMAEGPGLALPKINPVEVVVMPRLDPKLYSLL*

DNA
ATGACTTTTCTCTTTAGTACTCTCCAGTTGTCTCTCTTCTCTTTGGCCCTTGTAATCTTTGGTTACATTTTCCTCAGAAA
ACAATTGAGTAGATGTGAAGTTGATAGCTCCACGATTCCTGAGCCATTGGGAGCTTTGCCTCTATTCGGACACCTCCATC
TTTTGCGTGGCAAAAAACTCCTTTGCAAGAAATTAGCTGCCATGTCCCAAAAACATGGTCCTATCTTCTCCCTCAAGTTA
GGGTTTTATAGGCTGGTTGTAGCCAGCGACCCAAAAACGGTGAAAGATTGTTTCACCACCAACGACTTGGCTACAGCAAC
CAGACCCAATATAGCCTTTGGTCGGTACGTAGGCTACAACAATGCAAGTCTGACTCTGGCTCCCTATGGAGACTATTGGC
GTGAGTTACGTAAGATTGTCACCGTCCATCTATTCTCAAACCACAGTATAGAGATGCTTGGTCACATTCGTTCTTCAGAA
GTAAACACGTTGATCAAACACCTATACAAAGGGAATGGTGGAACTTCTATAGTGAAGATTGACATGTTATTTGAGTTTTT
GACCTTCAATATAATCCTTAGGAAGATGGTGGGGAAGAGGATTGGTTTCGGTGAAGTGAATAGCGATGAATGGCGTTATA
AGGAGGCCCTGAAGCATTGCGAGTACTTGGCTGTGATTCCTATGATAGGCGACGTTATTCCATGGTTGGGATGGTTGGAT
TTTGCAAAAAATTCTCAAATGAAGAGACTATTTAAGGAGCTTGACTCAGTCAACACCAAGTGGCTCCACGAACATCTCAA
GAAGAGATCAAGAAATGAGAAGGATCAAGAAAGAACAATCATGGATCTACTGCTAGACATCTTACCAGAGGATATTGTGA
TAAGTGGACACGTACGCGATGTCATTGTGAAGGCAACAATTTTGGCTCTCACATTAACAGGATCAGACAGCACATCCATC
ACTTTGACATGGGCGGTATCGCTGCTACTCAACAATCCAGCTGCTTTAGAAGCAGCACAAGAAGAGATTGATAATAGTGT
CGGCAAAGGTAGATGGATTGAAGAATCCGATATACAAAACCTCAAGTACCTACAAGCTATTGTTAAGGAAACGCACCGAC
TTTACCCGCCGGCTCCTCTAACAGGAATCCGCGAAGCACGTGAAGATTGTTTCGTGGGAGGATACCGTGTTGAGAAAGGC
ACACGCTTGCTCGTAAACATATGGAAACTTCATAGGGATCCCAAGATCTGGCCTGACCCCAAAACCTTTAAGCCTGAGAG
GTTCATGGAGGATAAATCACAATGTGAAAAGAGCAACTTTGAATACATTCCTTTCGGTTCGGGAAGGAGGTCGTGTCCGG
GAGTCAATCTTGGTCTAAGAGTTGTACACTTTGTATTGGCTAGATTGCTTCAAGGGTTTGAGTTACACAAAGTGTCTGAT
GAACCACTGGATATGGCTGAAGGGCCTGGTTTAGCCTTGCCAAAGATTAACCCGGTCGAAGTAGTTGTAATGCCTCGGCT
CGACCCGAAGTTGTATAGTTTACTCTAA