Details for Arabidopsis Locus AT3G25165

Position : Chr3 ( 5`- 9163340 .. 9163893 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G25165

Protein [Map View]
MKTFMIILLVICSILIVGRVEANDNKRKYLLLDPCLRPNAPPGCHRQPYKPRTPVNVYSRGCTTINRCRRVQNP*

DNA
ATGAAGACATTTATGATAATCTTGTTGGTGATTTGTAGCATCTTGATTGTAGGACGAGTTGAGGCTAACGATAACAAGAG
AAAATATCTACTACTCGATCCATGCTTGCGTCCTAATGCTCCACCAGGATGTCATCGTCAGCCATATAAACCCCGTACTC
CGGTTAACGTATATAGTCGTGGTTGCACCACAATCAACCGATGCCGCCGAGTGCAGAATCCGTGA