Details for Arabidopsis Locus AT3G25150

Position : Chr3 ( 5`- 9156957 .. 9160100 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G25150

Protein [Map View]
MNFSVLLYINSKATFFSSSSIFLFSRRSLFFSRFSCKTLTSAIAKEAFLRSSLRNFPVNRQLRLFQFLDRFFITSICAYL
LRESSSHLAFELDTDTHTAMAMLGAQQVPAAACTPDMVGNAFVPQYYHILHQSPEHVHRFYQEISKLGRPEENGLMSITS
TLQAIDKKIMALGYGVISAEIATVDTQESHGGGYIVLVTGYLTGKDSVRRTFSQTFFLAPQETGYFVLNDMFRFIDEGTV
VHGNQIPVNNVQAPVNTYQDTAAAKEIPDDFVQEKYVQENHAVKQTEVLSKSINEPEKVFTPSEDEQVSAAEEALVTETV
NEAPIEVQKVGESDSRTGEIPKRSYASIVKVMKENAAPMSASRTPTKVEPKKQEDQAIHIPLPTPLSEKSDSGANVAVNE
NNQENERALGPSIYLKGLPLDATPALLENEFQKFGLIRTNGIQVRSQKGFCFGFVEFESASSMQSAIEASPVMLNGHKVV
VEEKRSTARGNYRGRSTFGVNTGYRNEGGRGRGSFGGGRGGYGRTDFNGYGNNRGNNRGGYANRANGDGGGFPRANGNNG
RVRRGGGNDANRATKPVDDAPRVSVAA*

DNA
ATGAATTTCTCTGTATTACTTTATATAAACTCTAAAGCCACTTTTTTTTCTTCTTCTTCCATTTTTTTGTTCTCACGTCG
CTCTCTCTTTTTTTCGAGATTCAGCTGTAAAACCCTAACTAGCGCCATAGCCAAGGAAGCTTTCCTCAGATCGTCTCTCC
GAAATTTTCCGGTTAATCGTCAGTTAAGACTGTTCCAGTTCTTAGATCGGTTCTTCATAACTTCGATTTGTGCTTATCTT
CTTCGCGAATCTTCGTCGCATTTGGCGTTTGAATTGGATACTGATACTCATACTGCTATGGCGATGTTAGGTGCACAGCA
AGTTCCAGCAGCAGCTTGTACTCCAGATATGGTTGGGAATGCTTTTGTGCCCCAGTATTATCACATATTGCATCAATCAC
CTGAGCATGTTCACAGATTTTACCAAGAGATTAGCAAGTTAGGTCGTCCTGAAGAGAATGGTTTAATGAGCATCACTTCT
ACCTTGCAAGCTATTGACAAGAAGATAATGGCGCTTGGTTACGGTGTAATCAGTGCAGAGATAGCTACTGTGGACACACA
AGAATCTCATGGAGGTGGTTATATTGTACTGGTGACTGGGTATTTGACGGGAAAAGACAGTGTCAGGAGGACGTTTAGTC
AGACCTTCTTCCTTGCTCCACAGGAGACAGGATACTTTGTCTTGAATGATATGTTTCGATTCATTGATGAAGGCACTGTC
GTACATGGAAATCAGATTCCAGTGAACAACGTCCAAGCTCCTGTCAACACTTACCAGGACACAGCTGCTGCGAAGGAAAT
TCCAGATGACTTTGTTCAGGAGAAATATGTCCAAGAGAATCATGCTGTTAAGCAAACCGAGGTGTTGTCCAAGAGCATTA
ATGAGCCTGAAAAAGTGTTCACGCCCTCTGAAGATGAACAAGTATCAGCTGCAGAAGAAGCTCTGGTGACTGAAACAGTT
AATGAAGCACCAATTGAAGTGCAAAAGGTTGGAGAATCTGATTCTAGGACTGGCGAAATTCCAAAGAGATCTTATGCATC
AATTGTGAAGGTTATGAAAGAAAATGCTGCACCAATGTCTGCTTCGAGAACTCCAACAAAGGTGGAACCAAAGAAACAAG
AAGATCAAGCCATTCATATCCCTCTACCAACACCATTGTCTGAGAAATCAGATTCAGGAGCAAATGTTGCTGTAAATGAG
AACAATCAAGAGAATGAAAGAGCTCTAGGTCCATCCATCTATCTAAAGGGTTTACCCCTTGATGCAACACCTGCCTTGCT
TGAGAATGAGTTCCAGAAATTTGGACTTATTAGGACCAATGGAATTCAAGTGAGAAGCCAGAAGGGATTCTGTTTTGGTT
TTGTTGAGTTTGAATCCGCAAGTTCCATGCAAAGCGCTATCGAGGCATCACCTGTCATGCTCAATGGACACAAAGTTGTT
GTGGAGGAAAAGCGATCTACCGCAAGAGGGAACTATAGAGGACGTTCGACGTTTGGTGTAAACACAGGCTACAGAAACGA
AGGAGGAAGGGGTCGTGGGAGCTTTGGAGGTGGAAGAGGAGGATATGGCCGGACCGATTTCAACGGATATGGTAATAACA
GGGGAAACAATAGAGGCGGATACGCAAACCGAGCAAATGGTGATGGTGGTGGGTTCCCGAGGGCCAATGGTAACAATGGA
CGAGTAAGACGTGGTGGCGGAAATGATGCTAACAGAGCTACGAAACCCGTGGATGATGCTCCCCGTGTGTCTGTTGCTGC
GTAA