Details for Arabidopsis Locus AT3G25130

Position : Chr3 ( 5`- 9152404 .. 9153871 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G25130

Protein [Map View]
MSELALSSQEESPSSNKIGLSSLLLSDFHLFCSFILTHPFYFSYLLFFSPYIFKILSFLSPLFVTTTLLLLALLSTLHVQ
DTCLDSESLETQPSFLFSFCSKLGSVLEHKFDVNNEGFKSLEELEAYKMVVEACSMECASENEICSDELTFVDKFCSHES
TVSESLTDETLEEQVEIQPLKFEDVIVLEKEEETKKCEKEEVEEQKVKHKSDVVLDNREEPTKEESKAQKVDLVGDSNNE
SYDLPKLSNFLGEGEGKRNVVTKNEEEDNVSLQSFGSMRKEKEWRRTLACKLFEERHNADVGQGMDQLWETYETQTEKKQ
QTEEEKKKLKKKTKSMMKTKSIEKEVIVEEEDDDGIDHQQLCCLQALKFSTGKMHLGIARPNLLKLSKAFKGIGRFYNAN
KHSKKA*

DNA
ATGTCTGAACTTGCATTGTCATCTCAAGAAGAGTCTCCAAGTAGTAATAAGATTGGTTTATCTTCTCTTCTTCTCTCTGA
CTTTCATCTCTTTTGCTCATTTATCCTCACTCACCCTTTCTATTTTTCTTACTTGCTCTTCTTTTCACCTTACATCTTCA
AGATTCTCTCTTTTCTTTCACCACTCTTTGTCACCACCACACTCTTGCTTCTTGCCTTATTGAGTACTTTACATGTTCAA
GACACTTGTCTCGACTCTGAATCACTAGAAACACAACCAAGCTTCCTTTTCTCCTTTTGTAGTAAGCTTGGAAGTGTCTT
GGAACACAAGTTTGATGTCAACAATGAGGGTTTTAAGTCATTGGAGGAGTTGGAAGCGTATAAGATGGTCGTCGAGGCTT
GCTCGATGGAATGTGCGTCCGAGAATGAGATATGTTCGGATGAATTGACGTTTGTTGACAAATTCTGTAGCCATGAGAGC
ACGGTGTCGGAATCTTTGACCGATGAGACCCTTGAGGAGCAAGTTGAGATCCAACCGTTGAAGTTTGAGGATGTGATTGT
TTTGGAGAAAGAAGAAGAAACCAAGAAATGTGAAAAGGAAGAAGTAGAAGAACAAAAAGTCAAGCATAAAAGTGACGTTG
TCCTCGATAACAGAGAAGAGCCGACAAAAGAAGAATCCAAAGCTCAAAAAGTTGACCTTGTCGGAGATAGTAATAATGAA
AGTTATGATCTCCCAAAACTGAGCAATTTTCTCGGAGAAGGAGAAGGTAAAAGAAATGTAGTGACTAAGAACGAAGAAGA
AGATAATGTTTCTCTCCAAAGCTTTGGATCAATGAGAAAAGAGAAAGAATGGAGGAGAACATTGGCTTGCAAGCTATTTG
AAGAACGACACAATGCTGACGTTGGACAAGGCATGGATCAGCTGTGGGAGACTTACGAGACACAAACAGAGAAGAAGCAG
CAAACCGAAGAAGAGAAGAAGAAGCTCAAGAAGAAGACGAAGTCGATGATGAAGACAAAGAGTATAGAGAAGGAAGTTAT
AGTGGAGGAGGAAGATGATGATGGGATTGATCATCAGCAACTTTGTTGTTTACAAGCTTTGAAGTTCTCAACAGGGAAGA
TGCATTTGGGAATTGCGAGGCCTAACCTTTTGAAGCTATCTAAGGCTTTCAAAGGCATTGGACGTTTTTACAATGCTAAC
AAACATTCCAAGAAAGCTTGA