Details for Arabidopsis Locus AT3G25100

Position : Chr3 ( 5`- 9143999 .. 9146209 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G25100

Protein [Map View]
MVRIKKVESFYAKLRESATSLSSQNPLLIFPSTSDVDSLCALKVITHILESDSIQYSCFPVSSFLEIHKYAGPAGLCSTS
LESPPVTILLINWGCHRDLKLVLKLGPSARVFVVDSHRPIHLHNLSDYNEQVVVLHTDDDERQGDLAYDFDVLKLANESF
QLRVEDAGEESDEEEEDEEEDEEDDDDDDGDRPSKRRKMGDGVKVFKKLKRDYYKMGTFHGKPSGCLLFELSHMLRKNTN
ELLWLACVSLTDQFVHERLTDERYQAAVMELEQHINSSGNIDKITSVTLKDGTKVRAPDCSRISYEEEPRLMLLREWTLF
DSMLCSSYIATKLKTWSDNGIKKLKLLLARMGFALIECQQKFPYMSLEVKRKMKQEFDRFLPEYGLNDFYYRSFLRLHGY
SSRVSAADVVYGITALLESFLGSGGSSASKQFGEAYDALSLNNLDKLRSGMQQAIKVQRAILRQGSAAITKSGCIRSGRK
FRWVKIEDSMDAKYLGYPQALTKFCYFLMDALREKGARMKPMLCACASQQPGKILVVGVCGKPRLGAVRGNAFGNAFRKA
AQESRADYFHELFESSWIVLDASAVNSFMIRLTEKL*

DNA
ATGGTGAGGATTAAGAAAGTAGAATCGTTCTACGCGAAGCTTCGTGAGTCAGCTACTTCATTATCTTCACAGAATCCACT
TTTGATATTTCCTTCAACATCTGATGTTGATTCACTTTGTGCGCTTAAGGTTATTACTCATATCCTTGAATCAGATTCGA
TTCAGTATTCTTGTTTCCCTGTATCGTCTTTTTTGGAGATTCACAAGTATGCTGGTCCTGCTGGTTTGTGTTCTACTTCG
TTGGAGAGTCCTCCTGTTACTATACTGTTGATTAATTGGGGTTGTCACCGTGATTTGAAGCTTGTGTTGAAGTTAGGTCC
TTCGGCTCGTGTTTTCGTTGTTGATAGTCATAGGCCTATTCATTTGCATAATCTTAGTGATTATAATGAGCAAGTTGTTG
TTCTTCATACTGATGATGATGAGAGGCAAGGTGATTTGGCTTATGATTTCGATGTGTTGAAATTGGCGAATGAGAGCTTT
CAGTTACGTGTAGAAGATGCTGGTGAAGAATCTGATGAGGAGGAGGAAGATGAGGAAGAGGATGAGGAGGATGATGATGA
TGATGATGGTGATAGGCCAAGTAAGAGGAGGAAAATGGGAGATGGTGTGAAGGTTTTCAAGAAGCTAAAGAGGGATTATT
ACAAGATGGGGACTTTTCATGGGAAGCCATCGGGGTGTTTGTTGTTTGAGCTATCTCATATGTTGAGGAAGAACACTAAC
GAGTTGTTGTGGCTGGCTTGTGTTTCTTTGACTGATCAGTTTGTTCATGAGAGGTTGACTGATGAAAGATATCAAGCTGC
GGTTATGGAGCTTGAACAACACATCAATAGCTCAGGGAATATAGATAAGATCACTAGTGTTACTCTGAAAGATGGAACCA
AGGTTCGAGCACCAGACTGTTCAAGAATCTCTTATGAAGAAGAGCCTAGGCTTATGCTTCTTAGAGAGTGGACGTTGTTT
GACTCCATGCTTTGTTCTTCATACATTGCGACTAAGTTGAAGACATGGAGTGATAACGGTATCAAGAAACTTAAGCTTCT
TCTAGCGCGTATGGGATTTGCACTTATCGAGTGTCAGCAAAAGTTTCCGTACATGAGCCTTGAGGTGAAGAGGAAGATGA
AGCAAGAGTTTGATCGGTTTTTGCCAGAATATGGGCTTAATGATTTCTACTACCGGAGTTTCTTGCGGCTTCATGGTTAT
AGCTCAAGGGTCTCTGCTGCAGATGTTGTCTATGGTATTACAGCACTTCTTGAATCATTTCTTGGGTCAGGTGGCTCCTC
TGCTTCAAAACAGTTTGGTGAAGCTTATGATGCTCTGTCTTTGAACAATTTGGATAAACTTCGATCTGGGATGCAACAAG
CAATCAAGGTTCAACGAGCAATTCTTAGACAAGGAAGTGCAGCAATCACTAAAAGTGGATGCATTCGAAGTGGTAGGAAA
TTCAGATGGGTAAAGATTGAAGATTCAATGGATGCGAAGTATTTGGGATATCCTCAGGCCTTAACAAAATTCTGTTACTT
TCTGATGGATGCTTTGAGAGAGAAAGGAGCTAGGATGAAACCAATGCTATGTGCCTGCGCATCTCAACAACCTGGGAAGA
TACTCGTGGTTGGGGTTTGTGGGAAACCGAGGCTCGGGGCAGTCAGAGGGAATGCTTTTGGCAATGCTTTCAGAAAGGCA
GCTCAAGAAAGTAGAGCTGATTACTTTCACGAGCTATTCGAGTCTTCTTGGATTGTCTTGGATGCTTCTGCAGTTAACTC
TTTCATGATTAGATTAACCGAGAAGCTCTGA