Details for Arabidopsis Locus AT3G25050

Position : Chr3 ( 5`- 9126851 .. 9128416 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G25050

Protein [Map View]
MDYMRIFSVFVVTLWIIRVDARVFGGRGIEKFVTFGQNYIVTWGQSHVSTLHSGEEVDLYMDQSSGGGFESKDAYGSGLF
EMRIKVPSGNTGGIVTAFYLTSKGGGHDEIDFEFLGNNNGKPVTLQTNLFLNGEGNREERFLLWFNPTKHYHTYGLLWNP
YQIVFYVDNIPIRVYKNENGVSYPSKPMQVEASLWNGDDWATDGGRTKVNWSYSPFIAHFRDFALSGCNIDGRSNNVGAC
ESSNYWWNAGNYQRLSGNEQKLYEHVRSKYMNYDYCTDRSKYQTPPRECY*

DNA
ATGGACTATATGAGAATCTTTAGTGTTTTTGTAGTAACGTTATGGATCATAAGGGTTGATGCTAGGGTTTTCGGAGGACG
AGGAATCGAAAAATTTGTAACTTTCGGTCAGAATTATATTGTTACGTGGGGACAAAGTCATGTTTCTACACTCCATTCTG
GCGAAGAAGTTGATCTTTACATGGATCAATCTTCAGGTGGTGGGTTCGAATCCAAGGACGCCTACGGATCAGGTCTCTTT
GAAATGAGAATCAAAGTGCCTTCAGGAAATACTGGCGGCATCGTCACCGCTTTTTACTTGACGTCGAAAGGAGGTGGTCA
CGACGAGATTGACTTCGAGTTTCTAGGGAACAACAACGGAAAACCGGTAACGTTACAGACAAATCTGTTTCTAAATGGAG
AAGGAAACAGAGAAGAGAGGTTTTTGCTTTGGTTCAATCCAACCAAACACTACCACACTTATGGGCTTCTTTGGAACCCT
TACCAAATTGTGTTTTACGTGGACAACATCCCAATAAGAGTATACAAAAACGAAAACGGCGTAAGTTATCCATCAAAGCC
TATGCAAGTCGAGGCTAGTCTCTGGAACGGTGACGATTGGGCGACTGATGGTGGTCGGACTAAGGTTAACTGGTCATACT
CTCCTTTCATTGCACATTTCCGAGACTTCGCCTTATCCGGCTGCAACATAGATGGTCGGAGTAATAATGTCGGCGCTTGT
GAATCCTCCAACTACTGGTGGAATGCAGGCAACTATCAAAGATTAAGCGGAAACGAACAGAAACTTTATGAACATGTGAG
GAGCAAGTACATGAACTATGACTATTGTACTGATCGCTCTAAGTACCAAACTCCTCCTAGAGAATGTTATTGA