Details for Arabidopsis Locus AT3G25030

Position : Chr3 ( 5`- 9122197 .. 9123502 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G25030

Protein [Map View]
MIQMDGGDRLRVTLLDRMSTVESSRSCLTLEAILMADKNRTSPQILSPPPSRSQSNRSLVEVMQREHRHSRDKTAWKSLR
EKLRLKRNGSVWISSNSIPSLDTPIPNRDNVSHQLGFLLSNSGNVTEEASSVEGRIRLGAVLAEERALSAREEETPAERE
VEPARMSLMELLEENEGQMSFVSVDGEAEEEVAAVTAAEISCCVCMVRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCN
TTILEVLDLF*

DNA
ATGATTCAAATGGATGGTGGAGATAGGCTGAGAGTGACTTTATTAGATCGTATGTCAACGGTTGAGAGTAGCCGGAGCTG
TTTAACTCTTGAAGCTATTCTAATGGCTGATAAAAACAGAACCTCGCCGCAGATTCTCTCACCACCGCCGTCGAGGAGCC
AATCTAACCGGTCACTTGTTGAAGTCATGCAAAGAGAGCACCGACACAGTAGAGATAAAACCGCTTGGAAAAGTCTCCGT
GAAAAGCTCCGTCTTAAACGTAACGGTTCTGTTTGGATCTCGTCTAATTCTATCCCGAGTTTGGATACGCCTATTCCTAA
CCGGGATAACGTTAGCCACCAACTTGGTTTCCTCCTTTCTAACTCTGGAAATGTAACAGAGGAAGCTTCGTCGGTGGAGG
GAAGGATTCGGTTAGGAGCTGTGTTGGCAGAGGAGAGAGCATTATCGGCTAGAGAAGAGGAAACGCCGGCGGAGAGGGAA
GTGGAGCCGGCGAGGATGTCATTGATGGAGTTGTTGGAAGAGAATGAAGGGCAAATGAGTTTTGTAAGTGTCGACGGAGA
GGCGGAGGAGGAGGTGGCGGCAGTGACGGCGGCGGAGATAAGTTGTTGTGTGTGTATGGTTAGAAGCAAAGGAGCTGCGT
TTATTCCGTGTGGTCATACGTTTTGTAGGTTGTGTTCTAGAGAGCTTTGGGTTCAAAGAGGAAACTGTCCTCTCTGTAAT
ACCACAATTTTAGAAGTTCTTGATCTTTTTTAG