Details for Arabidopsis Locus AT3G24870

Position : Chr3 ( 5`- 9074665 .. 9085048 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24870

Protein [Map View]
MHGSVSGYLLVNAEVDSMGGVIDSGGGIGVKTSPRRTAIEKAQAELRQEYDVREERRRELEFLEKGGNPLDFKFGIATSH
SVQSTSLTDQQAEHFVNSEVKDSFALTASPHGDSVESSGRPGVPTISEPNTADNLLLFDSENKSVEGERNLRHPNRQNRT
SESERSSKAHTNQNTKETEDSAIFRPYARRNRSKISRDPARSSSTDLVQNRGGLATSISIRRGSVEGKGCIPEAANQKDM
HTTSVSCPVFANSNGNIVPKNRVSSNSLNTKVDGEPVVRESTAGSKTSLLKDEADISYSKSSAYLPVGESGLAGEKAQLV
STGGSPKAATIAGQKNSSTQLNGLRDSTVEEESLTNRGATGTNGLESESSHANNVEVNVDNERDLYKVDKLDSDEISMQK
TLRVEGLLDQTVGEMTKTKIEDETGQSTTIISECIPECEMQMKSVKIENQSHRSTAEMQTKEKSSETEKRLQDGLVVLEN
DSKVGSILSENPSSTLCSGIPQASVDTSSCTVGNSLLSGTDIEALKHQPSSDAVMLDTVKEDAILEEARIIQAKKKRIAE
LSCGTAPVEVREKSQWDFVLEEMAWLANDFAQERLWKMTAATQICHRVALTCQLRFEERNQHRKLKKIASVLSYAILQFW
SSVEAEVPGELEETSLGIVKETCQESNCLNGIRCLAAGVKEYASRFLKYNNSSISYHSAALSTPDNMCDPEILDISMVDQ
LTEASLFYSVPSGAMEVYLKSIESHLTRCEKSGSSMQEEVDTSAYDTAGDIGYNVTAFDEDEGETSTYYLPGAFESSRSF
NISHKKRKNLMKSHSARSYDLGDDLPYVNNTGGSNSSSLIVKRPDSNINAGSVPTRRVRTASRHRVVSPFGCATTGNLPV
PSKTDASSGDTSSFQDEYSSLHGGSAVQKGTEVESSVNFEKLLPYDMAETSGKPKKKKKTHQGSAYDQTWHLNPSVHVEQ
KDHWKKRPENNFDMNGLYGPHSAKKQKTTKQLVENNFDMAIPHTGSIPSPAASQMSNMSNPNKSIKFIGGRDRGRKIKGL
KISPGQHGSGNPWSLFEDQALVVLVHDMGPNWELISDAMNSTLKIKYIYRNPTECKDRHKILMDKTAGDGADSAEDSGNS
QSYPSTLPGIPKGSARQLFQRLQGPMEEDTLKSHFEKICLIGKKLHYRKTQNDGRDPKQIVPVHNSQVMALSQVFPNNLN
GGVLTPLDVCDASTSGQDVFSLENPGLPMLNQGTPVLPTSGAHPSTPGSSGVVLSNNLPTTSGLQSASVRDGRFNVPRGS
LPLDEQHRLQQFNQTLSGRNLQQPSLSTPAAVSGSDRGHRMVPGGNAMGVSGMNRNTPMSRPGFQGMASAAMPNTGNMHT
SGMVGIPNTGNIHSGGGASQGNSMIRPREAVQHMMRMQAAQGNSPGIPAFSNLSSGFTNQTTPVQAYPGHLSQQHQMSPQ
SHVLGNSHHPHLQSPSQATGAQQEAFAIRQRQIHQRYLQQQQQQFPASGSMMPHVQQPQGSSVSSSSQNSPQTQPPVSPQ
PLSMPPVSPSPNINAMAQQKPQKSQLALHGLGRSPQSGTSGVNNQAGKQRQRQLQQSARQHPHQRQPTQGQQLNKQLKGM
GRGNMIHQNITVDQSHLNGLTMPQGNQATEKGEIAVSVRPDQQSSVGTTTSTDLQSKPFVSPLSSNHSQQLPKSFPGALS
PSPQQQMQLHSDNSIQGQSSPATPCNILSTSSLSIAPAVAPSNHQHLLIHQKQRNQVQSTAQRVVQHNHLGNSELSKKSQ
AECMPRVPQSVTNTTQTASMGTTKGMPQASNDLKNIKAVGSTAVPALEPPSCVASVQSTASKVVNNSNTDSAGNDPVSTP
NQGLAQKHGIKGVTQRQQQSLPSEEKRPKLPEKPTVQNQKHLASEEQPHLEEAQELSSSKPPDTKVE*

DNA
ATGCATGGAAGCGTTTCAGGATATCTTCTAGTAAATGCTGAGGTTGATTCCATGGGAGGAGTTATCGATAGTGGAGGTGG
TATTGGTGTTAAAACATCTCCGCGCCGAACAGCTATTGAGAAGGCTCAAGCGGAGCTAAGGCAAGAGTATGATGTTCGTG
AGGAAAGGAGGAGAGAATTGGAGTTTCTAGAGAAAGGCGGTAATCCCTTGGATTTCAAGTTTGGTATTGCAACTTCACAT
AGCGTCCAATCTACATCACTCACAGATCAGCAAGCAGAGCATTTTGTAAACAGTGAAGTCAAAGATAGTTTTGCCCTGAC
TGCCTCACCACATGGTGACTCGGTGGAGAGTAGCGGTAGACCTGGAGTTCCTACAATTTCTGAACCCAATACAGCAGATA
ATCTTTTACTGTTTGATTCTGAAAACAAGTCAGTTGAAGGGGAAAGAAATTTGAGACATCCTAATAGGCAAAACAGAACT
TCTGAGTCAGAACGATCTTCCAAAGCACACACCAACCAGAATACCAAAGAAACAGAAGATTCTGCCATCTTTCGCCCGTA
TGCTCGGAGGAACAGATCGAAGATAAGTCGGGATCCAGCACGGTCAAGCTCTACGGATTTAGTTCAGAATCGTGGTGGTC
TTGCAACGTCTATATCTATTCGCAGAGGATCAGTGGAAGGAAAGGGTTGCATTCCCGAAGCAGCCAATCAAAAGGATATG
CATACAACTTCTGTATCTTGTCCAGTATTTGCAAATTCAAATGGTAATATCGTTCCGAAAAATAGAGTTTCCAGCAATTC
GCTGAATACTAAGGTGGATGGTGAACCTGTTGTACGAGAGAGTACTGCTGGATCCAAGACTAGTCTATTGAAAGATGAAG
CCGACATTTCGTATAGTAAAAGCTCTGCATATTTGCCAGTTGGAGAGTCTGGCCTTGCTGGGGAGAAGGCACAACTAGTT
TCGACTGGTGGTTCTCCCAAAGCTGCAACAATAGCTGGCCAGAAAAATAGTTCTACCCAACTGAATGGCCTAAGAGATTC
CACGGTAGAGGAAGAAAGCTTAACAAATAGAGGAGCTACAGGGACTAATGGGTTAGAGTCAGAGTCTTCTCATGCGAACA
ACGTAGAAGTAAATGTAGATAATGAAAGAGATCTTTATAAAGTGGACAAACTTGACTCTGATGAAATCTCTATGCAGAAG
ACTTTGAGAGTAGAGGGGTTACTAGATCAAACAGTTGGTGAAATGACCAAAACTAAGATTGAAGATGAGACAGGTCAATC
TACCACCATTATCAGTGAGTGCATTCCTGAATGTGAAATGCAGATGAAATCGGTTAAAATTGAAAATCAAAGTCACAGAA
GTACAGCTGAGATGCAAACTAAGGAGAAAAGTTCCGAGACTGAGAAAAGGCTTCAAGATGGGTTGGTTGTACTCGAAAAT
GACAGTAAAGTTGGTAGTATTTTATCTGAAAATCCTAGCAGCACGTTGTGCTCTGGAATTCCTCAGGCATCTGTAGACAC
AAGTTCTTGCACAGTTGGCAATAGTTTATTGTCAGGAACTGACATTGAAGCATTAAAACATCAGCCGAGCTCAGATGCAG
TTATGTTAGATACTGTCAAGGAGGACGCTATTCTTGAGGAGGCCCGGATTATACAGGCAAAGAAAAAAAGAATTGCCGAA
TTATCTTGTGGTACTGCACCAGTGGAGGTCCGTGAGAAATCTCAATGGGATTTTGTCCTCGAAGAAATGGCATGGCTGGC
AAATGATTTTGCGCAGGAGCGCCTTTGGAAAATGACTGCTGCCACACAAATTTGCCATCGAGTTGCTTTGACTTGTCAGT
TGAGATTTGAGGAACGAAATCAGCACAGAAAGCTGAAAAAAATAGCTTCAGTCCTATCTTATGCTATTTTACAATTCTGG
AGTTCTGTGGAGGCCGAGGTTCCTGGGGAGCTGGAGGAGACGAGCTTGGGAATTGTTAAGGAGACCTGCCAAGAATCTAA
TTGTTTGAATGGCATAAGATGTTTAGCTGCGGGTGTCAAGGAATATGCAAGTAGATTTTTGAAGTACAACAACTCTTCCA
TCTCCTATCATTCAGCTGCACTGTCAACACCTGACAATATGTGCGACCCAGAAATATTGGATATATCTATGGTTGATCAG
CTTACAGAAGCAAGCCTCTTTTATTCAGTTCCATCTGGTGCAATGGAGGTGTACCTTAAGTCCATTGAGTCGCATCTTAC
ACGTTGTGAGAAGTCTGGAAGTAGCATGCAGGAGGAGGTTGATACATCAGCCTATGATACTGCTGGAGATATAGGATATA
ATGTTACTGCGTTCGATGAGGATGAAGGAGAAACAAGTACCTATTATCTTCCGGGAGCTTTCGAGTCTAGCAGATCATTT
AATATAAGCCACAAAAAAAGGAAGAATCTGATGAAGTCTCATTCTGCCCGGTCATATGATCTTGGGGACGATTTACCATA
CGTCAACAACACAGGTGGCTCTAACTCATCAAGTTTGATAGTAAAAAGGCCTGACAGTAATATTAATGCCGGCTCAGTTC
CGACAAGGCGAGTGCGCACTGCTTCCAGGCATAGGGTTGTGAGTCCTTTTGGGTGTGCTACTACTGGGAATTTACCAGTG
CCCTCGAAGACAGATGCGTCTAGTGGGGATACTAGTTCTTTCCAGGATGAGTATAGTAGTTTGCATGGTGGATCGGCAGT
CCAAAAAGGCACAGAGGTTGAGTCAAGTGTTAATTTTGAAAAGCTGTTACCTTATGACATGGCTGAAACCTCAGGAAAAC
CTAAAAAGAAAAAGAAGACTCATCAGGGCTCCGCATATGACCAAACTTGGCATCTCAATCCGTCAGTCCATGTTGAACAG
AAGGACCACTGGAAGAAGCGACCAGAGAATAATTTCGATATGAATGGTCTGTATGGTCCTCATAGTGCAAAGAAGCAAAA
GACCACCAAGCAATTGGTAGAGAATAATTTTGATATGGCTATTCCTCACACTGGATCGATTCCTTCTCCGGCTGCTTCCC
AGATGAGCAATATGTCCAACCCCAACAAATCTATCAAATTTATTGGAGGTCGTGATAGGGGCAGAAAAATAAAAGGCCTG
AAGATTTCTCCTGGTCAGCATGGTTCTGGAAATCCATGGTCACTATTTGAGGATCAGGCGCTTGTTGTCCTGGTGCATGA
TATGGGGCCTAACTGGGAGCTCATTAGTGATGCAATGAACAGCACTCTTAAAATTAAGTATATATATCGCAATCCGACTG
AGTGCAAGGACCGGCATAAGATTCTGATGGATAAAACTGCTGGTGATGGGGCTGATAGTGCAGAAGATTCAGGGAATTCT
CAGTCTTATCCATCCACTTTGCCTGGCATACCAAAGGGAAGTGCGAGACAGTTGTTTCAACGACTGCAAGGGCCAATGGA
GGAAGATACCCTGAAGTCTCATTTTGAGAAGATTTGTTTGATTGGGAAGAAATTACATTATAGAAAGACACAGAACGATG
GTCGGGATCCCAAGCAAATAGTACCAGTTCACAATTCACAAGTCATGGCTCTCTCTCAAGTATTCCCGAATAATCTGAAT
GGAGGTGTTCTTACGCCCCTTGATGTCTGTGACGCATCAACTTCAGGTCAAGATGTATTTTCACTTGAAAATCCAGGTCT
TCCAATGTTGAATCAGGGAACGCCAGTGCTCCCTACTTCTGGAGCACATCCATCCACTCCTGGATCATCTGGTGTTGTTC
TGAGCAACAATTTGCCAACCACATCTGGCCTACAGAGTGCTTCTGTCAGGGATGGTAGATTCAATGTTCCTAGAGGGTCT
TTGCCACTTGATGAACAACACCGACTACAACAATTTAATCAAACGTTATCTGGTAGAAACCTGCAGCAGCCCTCCTTATC
AACTCCTGCAGCTGTCTCAGGATCTGATCGTGGACATCGCATGGTTCCTGGTGGAAATGCTATGGGTGTAAGTGGAATGA
ACAGGAACACACCCATGTCAAGGCCTGGTTTTCAAGGGATGGCCTCAGCAGCAATGCCAAATACTGGTAATATGCATACC
TCTGGCATGGTAGGAATTCCAAACACTGGAAATATTCATTCCGGAGGAGGAGCTTCTCAAGGAAACTCCATGATCAGGCC
TCGTGAAGCTGTGCAGCATATGATGCGGATGCAGGCTGCTCAAGGGAACAGTCCGGGGATCCCAGCTTTCAGTAATTTGA
GTTCTGGATTTACCAACCAGACAACTCCTGTTCAGGCGTACCCAGGCCATCTTTCCCAGCAGCATCAGATGTCACCGCAG
TCACATGTGCTTGGCAACTCGCATCATCCTCATCTCCAGAGCCCAAGTCAAGCCACTGGGGCACAGCAGGAAGCATTTGC
TATCCGTCAAAGACAAATTCACCAGAGGTATTTGCAGCAACAGCAACAGCAGTTTCCAGCATCTGGTTCTATGATGCCAC
ATGTACAACAACCTCAGGGCTCTTCTGTTTCTTCTTCTTCACAAAACAGTCCTCAGACTCAACCACCTGTTTCGCCCCAG
CCATTATCCATGCCCCCGGTGTCGCCCTCTCCTAATATTAATGCTATGGCACAACAGAAACCTCAAAAATCTCAGTTGGC
GCTTCATGGTTTGGGTAGGAGTCCTCAGTCTGGTACTTCTGGAGTGAACAATCAAGCTGGAAAACAAAGGCAGCGACAAC
TTCAGCAGTCTGCAAGACAGCATCCACACCAGCGGCAGCCAACACAAGGTCAACAGCTGAATAAACAACTGAAGGGGATG
GGTAGAGGCAACATGATCCATCAGAACATCACTGTCGATCAGTCACACCTGAATGGCCTTACCATGCCCCAAGGAAATCA
AGCTACCGAAAAAGGAGAGATAGCGGTTTCAGTTAGGCCTGATCAGCAGTCTAGTGTGGGGACTACCACGAGCACGGATC
TGCAGTCTAAACCATTTGTTTCTCCCTTGTCTTCAAATCATTCACAGCAACTGCCAAAATCATTCCCTGGTGCTTTGTCT
CCATCCCCTCAACAACAGATGCAATTACATTCAGACAATAGCATCCAAGGCCAGAGCTCACCTGCGACCCCATGTAATAT
TTTATCCACCTCTAGCCTGTCAATTGCACCAGCGGTTGCACCTTCTAACCATCAGCATTTGTTGATACACCAAAAGCAGC
GCAATCAAGTGCAATCAACAGCTCAGAGAGTTGTTCAACATAATCATCTAGGGAACTCTGAGTTATCAAAGAAGTCCCAA
GCTGAATGTATGCCACGTGTTCCACAGTCTGTAACCAATACCACCCAAACTGCTAGTATGGGTACGACCAAGGGTATGCC
TCAAGCGAGTAATGATTTGAAAAACATAAAAGCAGTTGGTTCTACTGCGGTGCCTGCTTTGGAACCTCCATCTTGTGTTG
CTTCTGTGCAAAGCACTGCTTCGAAAGTAGTAAACAATTCCAATACAGATTCAGCAGGAAATGATCCAGTATCAACACCG
AACCAAGGACTAGCTCAAAAGCACGGGATCAAGGGCGTTACACAGAGACAACAACAGTCTCTACCTTCAGAAGAAAAGAG
ACCGAAATTGCCAGAGAAGCCGACTGTACAAAATCAGAAACACCTTGCTTCTGAGGAGCAGCCTCATTTAGAAGAAGCAC
AAGAATTATCATCTTCCAAGCCTCCTGATACAAAAGTGGAATGA