Details for Arabidopsis Locus AT3G24860

Position : Chr3 ( 5`- 9073623 .. 9074682 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24860

Protein [Map View]
MATPSPTSSPPSDSNPNSAATPPHQKQPPSPPQPTNPSSPPPHTTVVALAASTSAVARKTQPVLWTQDETLLLIESYKEK
WFAIGRGPLKSTHWEEIAVAASSRSGVERTSTQCRHKIEKMRKRFRSERQSMGPISIWPFYNQMEELDSSNPAPISARPL
TRLPPNSNNRYVDDEEEDEEEDNNNYEEEEEEDERQSKSRSINYILRRPGTVNRFAGVGGGLLSWGQKERSSKRKRNDGD
GGERRRKGMRAVAAEIRAFAERVMVMEKKKIEFAKETVRLRKEMEIRRINLIQSSQTQLLQFINNAFDSF*

DNA
ATGGCGACGCCTTCGCCGACCTCCTCTCCTCCCTCTGATTCAAACCCTAATTCTGCCGCTACTCCGCCGCATCAGAAACA
ACCACCCTCTCCTCCTCAACCCACGAATCCATCCTCTCCACCACCGCACACCACCGTCGTAGCTTTAGCCGCATCAACCT
CCGCCGTCGCCAGAAAAACCCAACCTGTTCTCTGGACTCAAGACGAGACCCTCCTCTTAATCGAATCATACAAAGAGAAA
TGGTTCGCAATTGGTCGTGGTCCTCTAAAATCAACTCACTGGGAAGAGATCGCCGTTGCTGCCTCATCTCGTTCCGGCGT
TGAACGGACATCTACACAGTGTAGGCATAAGATCGAGAAGATGCGTAAAAGATTCCGATCTGAGAGACAGAGTATGGGAC
CTATCTCAATTTGGCCTTTCTATAATCAAATGGAGGAATTGGATTCTTCAAATCCTGCTCCGATCTCAGCTCGTCCTCTC
ACTCGTCTTCCTCCTAATTCGAATAATCGCTACGTAGACGACGAAGAAGAAGATGAAGAAGAGGATAACAATAACTACGA
AGAAGAGGAAGAAGAAGATGAGAGACAGAGCAAATCGAGGAGTATTAATTACATATTGAGAAGACCTGGAACTGTTAACA
GATTTGCTGGAGTTGGTGGAGGATTGTTGTCATGGGGACAAAAAGAGAGATCATCGAAGAGGAAGAGGAACGATGGAGAC
GGTGGTGAGAGGCGGAGGAAAGGAATGCGAGCCGTTGCAGCGGAGATTAGGGCGTTTGCTGAGAGAGTAATGGTAATGGA
GAAGAAGAAGATTGAGTTTGCTAAAGAGACTGTGAGACTTCGTAAGGAAATGGAGATTCGTAGAATCAATTTGATTCAGA
GTTCTCAAACTCAGCTTCTTCAATTTATCAACAATGCTTTTGATTCTTTCTAA