Details for Arabidopsis Locus AT3G24820

Position : Chr3 ( 5`- 9062365 .. 9064378 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24820

Protein [Map View]
MNIASRIRRSFLREKKESSDGNSLKNGSSVKEEGKDEILGVTDELIDHVRSFTIDTFKNFSLEDEEEEVSVNPLGDEDNG
MSSSANVKKDLSDWQEKHAVLVLSKSKELSQLRFKLCPRVLKEHQFWRIYFQLVRKIVAKYEVLAIQQAQIRRMAMEDSK
TSESKGVYEVEMSETKQRLSTGPATP*

DNA
ATGAATATAGCTTCGAGGATTCGACGAAGTTTTTTAAGAGAGAAGAAGGAATCTTCAGATGGGAATAGCTTGAAGAATGG
ATCGAGTGTTAAGGAAGAAGGTAAAGATGAGATTTTGGGAGTTACTGATGAGTTAATCGATCATGTCAGATCCTTCACCA
TTGATACGTTTAAGAACTTCTCTCTGGAAGATGAAGAAGAAGAAGTATCTGTGAATCCTTTGGGAGATGAAGATAATGGA
ATGAGTTCATCTGCAAATGTGAAGAAGGATTTGTCTGATTGGCAGGAGAAACACGCGGTTCTCGTGTTATCGAAATCGAA
GGAACTCTCACAGTTGAGATTCAAGTTATGCCCGCGAGTTTTAAAGGAACATCAGTTTTGGAGGATATATTTCCAGCTTG
TGAGGAAGATTGTGGCAAAATATGAGGTGCTAGCAATCCAACAGGCTCAAATCAGGAGGATGGCCATGGAAGACAGTAAA
ACTTCTGAAAGCAAGGGTGTATATGAAGTTGAAATGTCAGAAACAAAGCAAAGGTTGAGTACAGGACCTGCAACTCCGTG
A