Details for Arabidopsis Locus AT3G24800

Position : Chr3 ( 5`- 9055509 .. 9057998 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24800

Protein [Map View]
MAETMKDITMKNDESQEEEIPDQFLCCVCLELLYKPIVLSCGHLSCFWCVHKSMNGFRESHCPICRDPYVHFPSVCQKLY
FLLKKMYPLAHKKREEQVLKEEQERECFSPQIDLVLDLSVCSGDSLNVSDKQKVEECSNAANLLSSSSSRGDIPCIPKNQ
EPTDAKALNVHENELLKDNKVSKQISKDDLLCSACKELLVRPVVLNCGHVYCEGCVVDMAEESEKIKCQECNVCDPRGFP
KVCLILEQLLEENFPEEYNSRSSKVQKTLAHNSKGNIQSYLKEGPSLSNDNNNDDPWLANPGSNVHFGAGCDSCGVYPII
GDRYRCKDCKEEIGYDLCKDCYETPSKVPGRFNQQHTPDHRLELARSPQVLINFNSIGILLGPVISNEGMDTDEGEEGPP
GSSNESSSTE*

DNA
ATGGCCGAAACTATGAAAGATATTACGATGAAGAACGATGAATCACAGGAAGAAGAAATCCCCGATCAATTTCTCTGCTG
CGTTTGCCTGGAACTTCTTTACAAGCCAATTGTGTTATCTTGTGGTCATCTATCATGTTTTTGGTGCGTACATAAGTCCA
TGAATGGCTTTCGTGAGTCTCATTGTCCGATATGTAGAGACCCGTATGTTCACTTTCCCTCTGTGTGCCAGAAGCTTTAT
TTTCTGTTAAAGAAGATGTACCCACTTGCTCATAAGAAGAGAGAAGAACAAGTTTTAAAGGAAGAGCAAGAACGAGAATG
TTTTTCTCCTCAGATTGATCTTGTTTTGGATTTGTCTGTGTGTAGTGGAGATTCTCTCAATGTCTCTGATAAACAGAAGG
TGGAAGAGTGTTCGAATGCAGCGAACTTATTATCTAGTTCATCAAGTAGAGGTGACATTCCATGTATCCCCAAAAATCAA
GAACCCACAGATGCAAAAGCTCTTAATGTTCATGAAAATGAATTACTTAAGGATAACAAAGTCAGTAAGCAGATTTCGAA
AGATGATTTGCTCTGTTCAGCATGTAAGGAGCTGCTTGTACGACCCGTAGTTCTCAATTGCGGACATGTGTATTGTGAAG
GATGTGTAGTAGATATGGCTGAAGAAAGCGAAAAGATCAAATGTCAAGAGTGTAATGTTTGTGACCCAAGAGGATTTCCA
AAAGTTTGTTTGATTCTTGAACAGCTTTTGGAGGAAAACTTTCCTGAAGAATACAATTCAAGAAGCAGTAAGGTTCAGAA
AACGCTCGCCCATAATAGCAAAGGAAATATTCAAAGCTATCTCAAAGAAGGCCCGTCCTTATCAAACGACAATAACAATG
ATGATCCCTGGTTGGCAAACCCTGGATCAAATGTTCACTTTGGAGCTGGTTGTGATTCTTGTGGGGTGTATCCAATCATA
GGGGATCGATACAGATGCAAAGACTGCAAGGAGGAAATTGGGTATGACCTTTGCAAAGACTGTTACGAGACTCCTTCGAA
AGTTCCAGGGAGATTCAACCAGCAACACACTCCTGACCACAGGCTTGAGCTTGCACGGTCTCCTCAGGTTCTGATCAATT
TCAATTCTATCGGTATCCTTCTCGGACCCGTTATCTCAAATGAAGGCATGGATACAGATGAAGGCGAGGAAGGGCCTCCT
GGTTCTTCTAATGAGTCATCAAGCACAGAATGA